2024-05-05 11:09:57, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_204911 818 bp mRNA linear VRT 19-SEP-2023 DEFINITION Gallus gallus homeobox B8 (HOXB8), mRNA. ACCESSION NM_204911 XM_429258 VERSION NM_204911.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 818) AUTHORS Yang KX, Zhou H, Ding JM, He C, Niu Q, Gu CJ, Zhou ZX, Meng H and Huang QZ. TITLE Copy number variation in HOXB7 and HOXB8 involves in the formation of beard trait in chickens JOURNAL Anim Genet 51 (6), 958-963 (2020) PUBMED 33058257 REMARK GeneRIF: Copy number variation in HOXB7 and HOXB8 involves in the formation of beard trait in chickens. REFERENCE 2 (bases 1 to 818) AUTHORS Tang H, Finn RD and Thomas PD. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 3 (bases 1 to 818) AUTHORS Guo Y, Gu X, Sheng Z, Wang Y, Luo C, Liu R, Qu H, Shu D, Wen J, Crooijmans RP, Carlborg O, Zhao Y, Hu X and Li N. TITLE A Complex Structural Variation on Chromosome 27 Leads to the Ectopic Expression of HOXB8 and the Muffs and Beard Phenotype in Chickens JOURNAL PLoS Genet 12 (6), e1006071 (2016) PUBMED 27253709 REMARK GeneRIF: The results strongly suggest the Mb allele leading to the Muffs and beard phenotype in chickens leads to an altered ectopic expression of a homeotic gene HOXB8, to suggest a novel role for HOXB8 in modulating the regional development of the feather. Publication Status: Online-Only REFERENCE 4 (bases 1 to 818) AUTHORS Huber L, Ferdin M, Holzmann J, Stubbusch J and Rohrer H. TITLE HoxB8 in noradrenergic specification and differentiation of the autonomic nervous system JOURNAL Dev Biol 363 (1), 219-233 (2012) PUBMED 22236961 REMARK GeneRIF: Data suggest that HoxB8 acts by maintaining noradrenergic properties transiently expressed in ciliary neuron progenitors during normal development. REFERENCE 5 (bases 1 to 818) AUTHORS Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C, Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 818) AUTHORS Scotting PJ, Hewitt M and Keynes RJ. TITLE Isolation and analysis of chick homeobox cDNA clones JOURNAL Nucleic Acids Res 18 (13), 3999 (1990) PUBMED 1973835 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from U81801.1. On Mar 26, 2015 this sequence version replaced NM_204911.1. ##Evidence-Data-START## Transcript exon combination :: U81801.1, SRR13267649.255815.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992290, SAMEA103992323 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-818 U81801.1 11-828 FEATURES Location/Qualifiers source 1..818 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="27" /map="27" /breed="Leghorn" gene 1..818 /gene="HOXB8" /gene_synonym="CHOX-2.4; Hoxb-8; OX2.4" /note="homeobox B8" /db_xref="CGNC:66213" /db_xref="GeneID:395737" exon 1..462 /gene="HOXB8" /gene_synonym="CHOX-2.4; Hoxb-8; OX2.4" /inference="alignment:Splign:2.1.0" misc_feature 33..35 /gene="HOXB8" /gene_synonym="CHOX-2.4; Hoxb-8; OX2.4" /note="upstream in-frame stop codon" CDS 42..767 /gene="HOXB8" /gene_synonym="CHOX-2.4; Hoxb-8; OX2.4" /note="homeo box B8; Homeobox protein Hox-2.4" /codon_start=1 /product="homeobox protein Hox-B8" /protein_id="NP_990242.1" /db_xref="CGNC:66213" /db_xref="GeneID:395737" /translation="
MSSYFVNSLFSKYKTGDSLRPNYYDCGFAQDLGGRPTVVYGPSTGGTFQHPTQIQEFYHGASSLSSSPYQQNPCAVACHGDPSNFYGYDPLQRQSLFSAQESDLVQYTDCKLAASGLGEEAESSEQSPSPTQLFPWMRPQAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKQKMERAQEVDEEGEAQKADKK"
misc_feature order(474..488,492..494,543..545,561..563,600..602, 606..611,618..623,627..635,639..644) /gene="HOXB8" /gene_synonym="CHOX-2.4; Hoxb-8; OX2.4" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(480..482,489..491,609..611,618..623,630..632) /gene="HOXB8" /gene_synonym="CHOX-2.4; Hoxb-8; OX2.4" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 483..641 /gene="HOXB8" /gene_synonym="CHOX-2.4; Hoxb-8; OX2.4" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" exon 463..818 /gene="HOXB8" /gene_synonym="CHOX-2.4; Hoxb-8; OX2.4" /inference="alignment:Splign:2.1.0" ORIGIN
ttttcctcctcctccgtacaaatattattatttaaattaagatgagctcctattttgtcaactcactcttctccaaatacaaaaccggggactcgttgcgtcccaattactatgactgcgggttcgctcaggatcttgggggcagacccacggtggtgtacggacccagcacggggggcaccttccagcatccgacccaaatccaggagttctaccacggagcatcctcactctccagctccccttaccaacagaatccctgcgccgtggcgtgccatggggacccgagcaacttctatggctacgaccctttgcaaaggcagagcctcttcagcgcccaggagtcggacttggtgcagtacacggactgcaagcttgctgccagcggccttggagaggaggcggagagctcggagcagagcccttctccgacccagcttttcccctggatgcgaccgcaagccgctggacggaggagggggaggcaaacctacagccgctaccagacgctggaactggagaaggaatttctatttaatccctacctgacccgcaaacggaggatcgaggtctcgcatgccctgggattgacagaaaggcaggtcaaaatctggttccagaacaggaggatgaaatggaaaaaggaaaacaacaaagacaagtttcccagcagcaaatgcgagcaggaagaactggaaaaacagaaaatggaaagagcccaggaggtggacgaggaaggggaagcacagaaggcggacaagaaataaaaaggagttttgaggactgaaaggagagcgctgctggggtagagagccccc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]