LOCUS       NM_204674               2256 bp    mRNA    linear   VRT 24-SEP-2023
DEFINITION  Gallus gallus fibroblast growth factor 19 (FGF19), mRNA.
ACCESSION   NM_204674
VERSION     NM_204674.3
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 2256)
  AUTHORS   Tang H, Finn RD and Thomas PD.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 2256)
  AUTHORS   Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C,
            Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 2256)
  AUTHORS   Okamoto M, Bito T, Noji S and Ohuchi H.
  TITLE     Subtype-specific expression of Fgf19 during horizontal cell
            development of the chicken retina
  JOURNAL   Gene Expr Patterns 9 (5), 306-313 (2009)
   PUBMED   19272464
  REMARK    GeneRIF: Results suggest that Fgf19 is expressed by the early
            migratory horizontal precursors, and later by the presumptive
            axon-bearing HCs.
REFERENCE   4  (bases 1 to 2256)
  AUTHORS   Okamoto M, Tomonari S, Naito Y, Saigo K, Noji S, Ui-Tei K and
            Ohuchi H.
  TITLE     Introduction of silencing-inducing transgene against Fgf19 does not
            affect expression of Tbx5 and beta3-tubulin in the developing
            chicken retina
  JOURNAL   Dev Growth Differ 50 (3), 159-168 (2008)
   PUBMED   18312426
  REMARK    GeneRIF: Fgf19 is not required for expression of dorso-ventral
            morphogenetic genes in the eye
REFERENCE   5  (bases 1 to 2256)
  AUTHORS   Gimeno L and Martinez S.
  TITLE     Expression of chick Fgf19 and mouse Fgf15 orthologs is regulated in
            the developing brain by Fgf8 and Shh
  JOURNAL   Dev Dyn 236 (8), 2285-2297 (2007)
   PUBMED   17654705
  REMARK    GeneRIF: Fgf19 presents an expression in the isthmic alar plate,
            diencephalic and mesencephalic parabasal plates, hindbrain basal
            plate, as well as in the zona limitans intrathalamica (zli).
REFERENCE   6  (bases 1 to 2256)
  AUTHORS   Sanchez-Calderon H, Francisco-Morcillo J, Martin-Partido G and
            Hidalgo-Sanchez M.
  TITLE     Fgf19 expression patterns in the developing chick inner ear
  JOURNAL   Gene Expr Patterns 7 (1-2), 30-38 (2007)
   PUBMED   16798106
  REMARK    GeneRIF: detailed spatial and temporal patterns of Fgf19 expression
            in the developing inner ear from otic cup (stage 14) to 8 embryonic
            days (stage 34)
REFERENCE   7  (bases 1 to 2256)
  AUTHORS   Francisco-Morcillo J, Sanchez-Calderon H, Kawakami Y, Izpisua
            Belmonte JC, Hidalgo-Sanchez M and Martin-Partido G.
  TITLE     Expression of Fgf19 in the developing chick eye
  JOURNAL   Brain Res Dev Brain Res 156 (1), 104-109 (2005)
   PUBMED   15862633
  REMARK    GeneRIF: Fgf19 was expressed in a transient manner in postmitotic
            neuroblasts during the migration from the ventricular surface to
            their final location. and in retina not detected at p30.
REFERENCE   8  (bases 1 to 2256)
  AUTHORS   Kurose H, Bito T, Adachi T, Shimizu M, Noji S and Ohuchi H.
  TITLE     Expression of Fibroblast growth factor 19 (Fgf19) during chicken
            embryogenesis and eye development, compared with Fgf15 expression
            in the mouse
  JOURNAL   Gene Expr Patterns 4 (6), 687-693 (2004)
   PUBMED   15465490
  REMARK    GeneRIF: Fgf19 is expressed in the developing chicken retina
REFERENCE   9  (bases 1 to 2256)
  AUTHORS   Ladher RK, Anakwe KU, Gurney AL, Schoenwolf GC and Francis-West PH.
  TITLE     Identification of synergistic signals initiating inner ear
            development
  JOURNAL   Science 290 (5498), 1965-1967 (2000)
   PUBMED   11110663
  REMARK    GeneRIF: Induces the inner ear
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAENSK010000214.1.
            
            On Nov 8, 2021 this sequence version replaced NM_204674.2.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF315355.1, BU122912.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN03376184 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-358               JAENSK010000214.1  11146909-11147266   c
            359-462             JAENSK010000214.1  11146701-11146804   c
            463-2256            JAENSK010000214.1  11142347-11144140   c
FEATURES             Location/Qualifiers
     source          1..2256
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="5"
                     /map="5"
     gene            1..2256
                     /gene="FGF19"
                     /gene_synonym="FGF-19"
                     /note="fibroblast growth factor 19"
                     /db_xref="CGNC:66203"
                     /db_xref="GeneID:395394"
     exon            1..358
                     /gene="FGF19"
                     /gene_synonym="FGF-19"
                     /inference="alignment:Splign:2.1.0"
     CDS             121..795
                     /gene="FGF19"
                     /gene_synonym="FGF-19"
                     /codon_start=1
                     /product="fibroblast growth factor 19 precursor"
                     /protein_id="NP_990005.2"
                     /db_xref="CGNC:66203"
                     /db_xref="GeneID:395394"
                     /translation="

MGPRPAAPGAALALLGIAAAAAAARSLPLPDAGPHVNYGWGEPIRLRHLYTASKHGLFSCFLRIGGDGRVDAVGSQSPQSLLEIRAVAVRTVAIKGVQSSRYLCMDEAGRLHGQLSYSIEDCSFEEEIRPDGYNVYKSKKYGISVSLSSAKQRQQFKGKDFLPLSHFLPMINTVPVEVTDFGEYGDYSQAFEPEVYSSPLETDSMDPFGITSKLSPVKSPSFQK"

     sig_peptide     121..189
                     /gene="FGF19"
                     /gene_synonym="FGF-19"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     misc_feature    247..630
                     /gene="FGF19"
                     /gene_synonym="FGF-19"
                     /note="Acidic and basic fibroblast growth factor family;
                     FGFs are mitogens, which stimulate growth or
                     differentiation of cells of mesodermal or neuroectodermal
                     origin. The family plays essential roles in patterning and
                     differentiation during vertebrate...; Region: FGF;
                     cl00060"
                     /db_xref="CDD:444674"
     misc_feature    order(259..261,268..270,373..375,379..381,385..387,
                     469..471,496..498,505..522,526..528,616..618,622..624,
                     628..630)
                     /gene="FGF19"
                     /gene_synonym="FGF-19"
                     /note="receptor interaction site [active]"
                     /db_xref="CDD:238015"
     misc_feature    order(562..567,580..582,589..591,607..609)
                     /gene="FGF19"
                     /gene_synonym="FGF-19"
                     /note="heparin binding site (glycine box) [chemical
                     binding]; other site"
                     /db_xref="CDD:238015"
     exon            359..462
                     /gene="FGF19"
                     /gene_synonym="FGF-19"
                     /inference="alignment:Splign:2.1.0"
     exon            463..2256
                     /gene="FGF19"
                     /gene_synonym="FGF-19"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

acaccgccagccgcacagagcgcccaaccccgtatcgcaccgcaccgccccgcaccgcccgcggcaacgccgccgcccgacccgagcccgagcccgagtctgagtccgaggccgccgcggatggggccgcgccccgctgcacccggcgctgccctggcgctgctggggatcgccgccgccgccgccgccgccaggtccctgccgctgcccgacgcgggtccgcacgtcaactacggctggggggaacccatccggctgcggcacctctacaccgccagcaagcacgggctcttcagctgcttcctgcgcattggcggcgacggccgggtggacgctgtcggtagccagagcccgcagagtctgttggagatccgcgccgtggcggtgcgcaccgtggccatcaagggcgtgcagagctcccgctacctctgcatggacgaggcggggcggctgcacgggcagctcagctattccattgaggactgttcctttgaagaggagattcgtccagacggctacaacgtgtataaatcaaagaaatacgggatatcggtgtctttgagcagtgccaaacaaagacagcaattcaaaggaaaagattttctcccgctgtctcacttcttacccatgatcaacactgtgccagtggaggtgacagactttggtgaatatggtgattacagccaggcttttgagccagaggtctactcatcgcctctcgaaacggacagcatggatccctttgggatcacttccaaactgtctccagtgaagagccccagctttcagaaatgactctgattgcacacgcggttttaaagagataccgcagaatgttgcaggtttttagcttcttgtgtagtgatgtctcaaacgtttttttcacgtctcagtatggagacggcatttcccgtacaatgtgttgtacctataagagctgagtgcccagttgccatattcgaaagaattgcctctccgtagtatacttggaaaagaaaaattaaataagagcagcttaacaaattcatcagagttcctccattactgtggtgatgataaaatacatagctttcgtacatcaaattcattaccacatatgttcacctgttgtttctgttcatatatataaatacaggaaatcttgccatccacagggaagttcacaaccttgtagacaaacatttggaacaaaacacagttaaggaagactgagcaagtgtggttatgtgaactaaagttagcgctgtttcttgaaaagctgctgacaaccttctgggaaggctttctgttgaaagcataccactgaaaaacaattctgctgatatattgtgctttttcttcccttaggaaagaggggaagagaggaaaatatttcttccttccccaactgctaagggataccttggaaaactggattttattttataggctaatttatgttcactacgggatcttcatcgtccagcatagacttgtctttaatgctaatgggaattcagcatgtgggtaggagtgtatacagaactagcatttgtgttcatctggtaggaatgagcagttcaaattagtgtccagatataggttctgctgtatatactcatgtacgttggtagcaaataggaagtctgaaaatggatgatgtgtaggtcacatcagttgcaaagaacatttctgtgttttgcctttaaccgccagcaattcttctaggtccacccaggcttcatcctgcaccgtttgaaaccgtggagatgcaatttagggactcaaacgctgcagaactgagctggccatgccgtggttcttgcagggagggatcgtgtggatctcatggccaaaaagcatgtctgatgtcttcagttctgttctccccttgtgacaatttaacaaaggaataaccaaagagaaaccaaaagaagacaaatgtaagggttcatccactcatttccaaaggctcgcttataatagagatttctatacaaaaagctctactgaaaacactggtgttcttctgacctagcacttcattgccaatgcaatatttataattaatttattaaatacatacctctgtttattttgttactgttatttatgctcaaaattctatttatatactcttgaaggtgggttttttggttgtaacaaattttgcgaagttttgtaatcattaaattgtaggaaacaatagctttttaaatctctgttcattattggtagtgtaatatgtacatttgcaataaaaaatcgtcttcagta

//