GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-05 17:09:14, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001389365            2111 bp    mRNA    linear   VRT 23-SEP-2023
DEFINITION  Gallus gallus SIX homeobox 6 (SIX6), mRNA.
ACCESSION   NM_001389365 NM_204994 XM_015287285
VERSION     NM_001389365.2
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 2111)
  AUTHORS   Tang H, Finn RD and Thomas PD.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 2111)
  AUTHORS   Lopez-Rios J, Gallardo ME, Rodriguez de Cordoba S and Bovolenta P.
  TITLE     Six9 (Optx2), a new member of the six gene family of transcription
            factors, is expressed at early stages of vertebrate ocular and
            pituitary development
  JOURNAL   Mech Dev 83 (1-2), 155-159 (1999)
   PUBMED   10381575
REFERENCE   3  (bases 1 to 2111)
  AUTHORS   Toy J, Yang JM, Leppert GS and Sundin OH.
  TITLE     The optx2 homeobox gene is expressed in early precursors of the eye
            and activates retina-specific genes
  JOURNAL   Proc Natl Acad Sci U S A 95 (18), 10643-10648 (1998)
   PUBMED   9724757
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAENSK010000215.1.
            
            On Sep 23, 2021 this sequence version replaced NM_001389365.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AJ011786.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992290, SAMEA103992393
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-753               JAENSK010000215.1  24892429-24893181   c
            754-2111            JAENSK010000215.1  24890375-24891732   c
FEATURES             Location/Qualifiers
     source          1..2111
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="5"
                     /map="5"
     gene            1..2111
                     /gene="SIX6"
                     /gene_synonym="OPTX2; Six9"
                     /note="SIX homeobox 6"
                     /db_xref="CGNC:14168"
                     /db_xref="GeneID:395843"
     exon            1..753
                     /gene="SIX6"
                     /gene_synonym="OPTX2; Six9"
                     /inference="alignment:Splign:2.1.0"
     CDS             182..922
                     /gene="SIX6"
                     /gene_synonym="OPTX2; Six9"
                     /note="optic homeobox 2; sine oculis homeobox homolog 6"
                     /codon_start=1
                     /product="homeobox protein SIX6"
                     /protein_id="NP_001376294.1"
                     /db_xref="CGNC:14168"
                     /db_xref="GeneID:395843"
                     /translation="
MFQLPILNFSPQQVAGVCETLEESGDIERLGRFLWSLPVAPAACEALNKNESVLRARAIVAFHTGNYRELYHILENHKFTKESHGKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQQQVLAQGSGRSLQAEEESGGEAGGAASSPAVSLSSKAATSAISITSSDSECDI"
     misc_feature    206..547
                     /gene="SIX6"
                     /gene_synonym="OPTX2; Six9"
                     /note="Transcriptional regulator, SIX1, N-terminal SD
                     domain; Region: SIX1_SD; pfam16878"
                     /db_xref="CDD:435624"
     misc_feature    569..715
                     /gene="SIX6"
                     /gene_synonym="OPTX2; Six9"
                     /note="Homeodomain; DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:238039"
     misc_feature    order(572..574,581..583,701..703,710..715)
                     /gene="SIX6"
                     /gene_synonym="OPTX2; Six9"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    764..919
                     /gene="SIX6"
                     /gene_synonym="OPTX2; Six9"
                     /note="propagated from UniProtKB/Swiss-Prot (O93307.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            754..2111
                     /gene="SIX6"
                     /gene_synonym="OPTX2; Six9"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
agtcgccgccgagcgctccccatcgcctctccgccccgcgccgccctcccgccgcagttccgtctctccgccggctccgggcgaggcagaagcggggctcggggcggccgccggggccgctgcccgcttccccgccgcggggctgtgcgagccggcggcggggggcatcggagccgcctccatgttccagctgcccatcctcaatttcagcccgcagcaggtggccggggtatgcgagaccctggaggaaagcggggacattgagcgcctggggcgcttcctctggtcgctgcccgtggccccggcggcttgcgaagcgctcaacaagaacgagtcggtgctgagagcccgggccatcgtggccttccacacggggaactacagagagctctaccatatcctggagaaccacaagttcaccaaggagtcccacggcaagctgcaagccctctggctggaagcgcactaccaggaggcggagaagctgcggggcagacccttggggccggtggacaaataccgggtgaggaagaagttccctctgccgcgcaccatctgggacggcgagcagaagacgcattgcttcaaggagcggacgaggcatttgctgcgggagtggtacctgcaggacccttaccccaaccccagcaaaaagagggaactggctcaggccacgggacttacccccacgcaggtgggcaactggttcaaaaaccgcaggcaaagggacagggcggcggccgccaagaacaggctacagcagcaggtcctagcgcagggctcggggcgctcgctgcaagcggaggaggagagcggcggggaggcggggggggcggcctccagcccagccgtcagcctctccagcaaagcggccacctccgccatctccatcacatccagcgacagtgaatgtgacatctgacaccgagcgccatgacgaagcggggggggctccccagtgcctatcgctgtccccggagccggggtacggagccccccccgagccgccggccccgcagaggactgcattaaaacccgtgagaaaacgaaacaaaacaaaacaaaatcgttgtcgcctttatttccgaggattcgcagaattcatgcctgaaaaaaaaaaaaagaaagaaagaaaaaaaaaggaaaaaaaaaagaaaaaagggggggaagggaaaaaaagaaaagaaaaaaaaaggaggaaaaaatggaaaaaaatacagaaaatgtttaaaaaaaaaaaagaaaagaaaaagaaaagaatgccaactgcaaaatgcccgagcgcccttatccggaggggggggggctccgtgtggaacaggcgctgttctcgtggctgggtttctctttactttaaaggggtttttatatatatatatataatgtttatttacttatttaagggatggcgatggtagatttttttctattattattattaattataatttttttttggcttgttctctgtgtgcacaggtgacttgtagagcatgtgcaggacgaaaactgtatgaagcagcctaaaaaccgtaataaaatatttggtgaacgaccttcggatctgctttcaaatggcagcgtacggccccgggcccggcggtccgcgcagcgcagctccggcagccgcgggcacttcggaaccaaagagccgcgtcccggcacggggtgaagtgtcggcaatgggggggccgggggggtcgggaaggggagaggggagcggtcgtaggaggatgcggtgcgaggggaaaggagggaggaggcagcgctgcagtgtctcgggttagagatttcgggggaatgaatgggaagggatggggaaaaggaggggaaaaaacgaggagaggagaaagaagggtgaattgtgccaaggcggggacgccgggcttcctccccggtgagtgcatagaggctggaaatgagcagccccgtgcccggggagggtcggatcggggcgaaatgaccccaaatctcagcgccgtggggtcccccccttctgtttgacggctgttttttcggcaggaaagcaaacggcggctccgaggagcgggctaagctttcaccctcaacagaaggattttatattatacaatttgacattgatctttaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]