2024-05-05 17:09:14, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001389365 2111 bp mRNA linear VRT 23-SEP-2023 DEFINITION Gallus gallus SIX homeobox 6 (SIX6), mRNA. ACCESSION NM_001389365 NM_204994 XM_015287285 VERSION NM_001389365.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 2111) AUTHORS Tang H, Finn RD and Thomas PD. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 2111) AUTHORS Lopez-Rios J, Gallardo ME, Rodriguez de Cordoba S and Bovolenta P. TITLE Six9 (Optx2), a new member of the six gene family of transcription factors, is expressed at early stages of vertebrate ocular and pituitary development JOURNAL Mech Dev 83 (1-2), 155-159 (1999) PUBMED 10381575 REFERENCE 3 (bases 1 to 2111) AUTHORS Toy J, Yang JM, Leppert GS and Sundin OH. TITLE The optx2 homeobox gene is expressed in early precursors of the eye and activates retina-specific genes JOURNAL Proc Natl Acad Sci U S A 95 (18), 10643-10648 (1998) PUBMED 9724757 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000215.1. On Sep 23, 2021 this sequence version replaced NM_001389365.1. ##Evidence-Data-START## Transcript exon combination :: AJ011786.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992290, SAMEA103992393 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-753 JAENSK010000215.1 24892429-24893181 c 754-2111 JAENSK010000215.1 24890375-24891732 c FEATURES Location/Qualifiers source 1..2111 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="5" /map="5" gene 1..2111 /gene="SIX6" /gene_synonym="OPTX2; Six9" /note="SIX homeobox 6" /db_xref="CGNC:14168" /db_xref="GeneID:395843" exon 1..753 /gene="SIX6" /gene_synonym="OPTX2; Six9" /inference="alignment:Splign:2.1.0" CDS 182..922 /gene="SIX6" /gene_synonym="OPTX2; Six9" /note="optic homeobox 2; sine oculis homeobox homolog 6" /codon_start=1 /product="homeobox protein SIX6" /protein_id="NP_001376294.1" /db_xref="CGNC:14168" /db_xref="GeneID:395843" /translation="
MFQLPILNFSPQQVAGVCETLEESGDIERLGRFLWSLPVAPAACEALNKNESVLRARAIVAFHTGNYRELYHILENHKFTKESHGKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQQQVLAQGSGRSLQAEEESGGEAGGAASSPAVSLSSKAATSAISITSSDSECDI"
misc_feature 206..547 /gene="SIX6" /gene_synonym="OPTX2; Six9" /note="Transcriptional regulator, SIX1, N-terminal SD domain; Region: SIX1_SD; pfam16878" /db_xref="CDD:435624" misc_feature 569..715 /gene="SIX6" /gene_synonym="OPTX2; Six9" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:238039" misc_feature order(572..574,581..583,701..703,710..715) /gene="SIX6" /gene_synonym="OPTX2; Six9" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 764..919 /gene="SIX6" /gene_synonym="OPTX2; Six9" /note="propagated from UniProtKB/Swiss-Prot (O93307.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" exon 754..2111 /gene="SIX6" /gene_synonym="OPTX2; Six9" /inference="alignment:Splign:2.1.0" ORIGIN
agtcgccgccgagcgctccccatcgcctctccgccccgcgccgccctcccgccgcagttccgtctctccgccggctccgggcgaggcagaagcggggctcggggcggccgccggggccgctgcccgcttccccgccgcggggctgtgcgagccggcggcggggggcatcggagccgcctccatgttccagctgcccatcctcaatttcagcccgcagcaggtggccggggtatgcgagaccctggaggaaagcggggacattgagcgcctggggcgcttcctctggtcgctgcccgtggccccggcggcttgcgaagcgctcaacaagaacgagtcggtgctgagagcccgggccatcgtggccttccacacggggaactacagagagctctaccatatcctggagaaccacaagttcaccaaggagtcccacggcaagctgcaagccctctggctggaagcgcactaccaggaggcggagaagctgcggggcagacccttggggccggtggacaaataccgggtgaggaagaagttccctctgccgcgcaccatctgggacggcgagcagaagacgcattgcttcaaggagcggacgaggcatttgctgcgggagtggtacctgcaggacccttaccccaaccccagcaaaaagagggaactggctcaggccacgggacttacccccacgcaggtgggcaactggttcaaaaaccgcaggcaaagggacagggcggcggccgccaagaacaggctacagcagcaggtcctagcgcagggctcggggcgctcgctgcaagcggaggaggagagcggcggggaggcggggggggcggcctccagcccagccgtcagcctctccagcaaagcggccacctccgccatctccatcacatccagcgacagtgaatgtgacatctgacaccgagcgccatgacgaagcggggggggctccccagtgcctatcgctgtccccggagccggggtacggagccccccccgagccgccggccccgcagaggactgcattaaaacccgtgagaaaacgaaacaaaacaaaacaaaatcgttgtcgcctttatttccgaggattcgcagaattcatgcctgaaaaaaaaaaaaagaaagaaagaaaaaaaaaggaaaaaaaaaagaaaaaagggggggaagggaaaaaaagaaaagaaaaaaaaaggaggaaaaaatggaaaaaaatacagaaaatgtttaaaaaaaaaaaagaaaagaaaaagaaaagaatgccaactgcaaaatgcccgagcgcccttatccggaggggggggggctccgtgtggaacaggcgctgttctcgtggctgggtttctctttactttaaaggggtttttatatatatatatataatgtttatttacttatttaagggatggcgatggtagatttttttctattattattattaattataatttttttttggcttgttctctgtgtgcacaggtgacttgtagagcatgtgcaggacgaaaactgtatgaagcagcctaaaaaccgtaataaaatatttggtgaacgaccttcggatctgctttcaaatggcagcgtacggccccgggcccggcggtccgcgcagcgcagctccggcagccgcgggcacttcggaaccaaagagccgcgtcccggcacggggtgaagtgtcggcaatgggggggccgggggggtcgggaaggggagaggggagcggtcgtaggaggatgcggtgcgaggggaaaggagggaggaggcagcgctgcagtgtctcgggttagagatttcgggggaatgaatgggaagggatggggaaaaggaggggaaaaaacgaggagaggagaaagaagggtgaattgtgccaaggcggggacgccgggcttcctccccggtgagtgcatagaggctggaaatgagcagccccgtgcccggggagggtcggatcggggcgaaatgaccccaaatctcagcgccgtggggtcccccccttctgtttgacggctgttttttcggcaggaaagcaaacggcggctccgaggagcgggctaagctttcaccctcaacagaaggattttatattatacaatttgacattgatctttaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]