2024-05-20 10:23:29, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001276324 1923 bp mRNA linear VRT 19-SEP-2023 DEFINITION Gallus gallus endoplasmic reticulum protein 29 (ERP29), mRNA. ACCESSION NM_001276324 XM_415173 VERSION NM_001276324.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 1923) AUTHORS Tang H, Finn RD and Thomas PD. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 1923) AUTHORS Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C, Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1923) AUTHORS Mkrtchian S and Sandalova T. TITLE ERp29, an unusual redox-inactive member of the thioredoxin family JOURNAL Antioxid Redox Signal 8 (3-4), 325-337 (2006) PUBMED 16677078 REMARK Review article REFERENCE 4 (bases 1 to 1923) AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P, Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci P, Hayashizaki Y and Buerstedde JM. TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate gene function analysis JOURNAL Genome Biol 6 (1), R6 (2005) PUBMED 15642098 REFERENCE 5 (bases 1 to 1923) AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. TITLE A comprehensive collection of chicken cDNAs JOURNAL Curr Biol 12 (22), 1965-1969 (2002) PUBMED 12445392 REFERENCE 6 (bases 1 to 1923) AUTHORS Abdrakhmanov I, Lodygin D, Geroth P, Arakawa H, Law A, Plachy J, Korn B and Buerstedde JM. TITLE A large database of chicken bursal ESTs as a resource for the analysis of vertebrate gene function JOURNAL Genome Res 10 (12), 2062-2069 (2000) PUBMED 11116100 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AJ720735.1, BU401484.1, AJ397785.1, BU350207.1, BU139356.1 and CK607880.1. On Feb 2, 2013 this sequence version replaced XM_415173.3. Sequence Note: This RefSeq record was created from transcript data from different strains because no single transcript from the same strain was available for the full length of the gene. The extent of this transcript is supported by transcript alignments and orthologous data. ##Evidence-Data-START## Transcript exon combination :: AJ720735.1, BU369995.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992432, SAMEA103992533 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-364 AJ720735.1 2-365 365-705 BU401484.1 337-677 706-997 AJ397785.1 373-664 998-1464 BU350207.1 13-479 1465-1711 BU139356.1 245-491 1712-1923 CK607880.1 1-212 c FEATURES Location/Qualifiers source 1..1923 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="15" /map="15" /breed="Leghorn" gene 1..1923 /gene="ERP29" /gene_synonym="C12orf8" /note="endoplasmic reticulum protein 29" /db_xref="CGNC:50366" /db_xref="GeneID:416882" exon 1..143 /gene="ERP29" /gene_synonym="C12orf8" /inference="alignment:Splign:2.1.0" CDS 27..785 /gene="ERP29" /gene_synonym="C12orf8" /note="endoplasmic reticulum resident protein 29" /codon_start=1 /product="endoplasmic reticulum resident protein 29 precursor" /protein_id="NP_001263253.1" /db_xref="CGNC:50366" /db_xref="GeneID:416882" /translation="
MAAAAAAGSLLLCLLGLALPGSALHTKGSVPLDTITFYKVIPKHKFVLVKFDTQYPYGEKQDEFKKLAESSGSSEDLLVAEVGISDYGDKLNTELGEKYKLDKEKYPIFYLFQDGDFDNPLPYSGHIKAGAIQRWLKSNGIYLGMPGCLKEYDVLASKFMSVTDKSERQSLLKKGQQSLEKAKETEKKSAEQYLKIMSKILEQGEEFAANEVVRITKLIEKNKMSDGKKEELQKSLNILASFLKKNNEKDEL"
sig_peptide 27..95 /gene="ERP29" /gene_synonym="C12orf8" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 105..446 /gene="ERP29" /gene_synonym="C12orf8" /note="PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells. It forms homodimers and higher oligomers in vitro and in vivo. It contains a redox inactive TRX-like...; Region: PDI_a_ERp29_N; cd03007" /db_xref="CDD:239305" misc_feature order(105..110,114..116,123..125,129..131,153..155, 159..161,246..254) /gene="ERP29" /gene_synonym="C12orf8" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:239305" misc_feature 465..752 /gene="ERP29" /gene_synonym="C12orf8" /note="Endoplasmic reticulum protein ERp29, C-terminal domain; Region: ERp29; pfam07749" /db_xref="CDD:429634" exon 144..282 /gene="ERP29" /gene_synonym="C12orf8" /inference="alignment:Splign:2.1.0" exon 283..1916 /gene="ERP29" /gene_synonym="C12orf8" /inference="alignment:Splign:2.1.0" regulatory 1895..1900 /regulatory_class="polyA_signal_sequence" /gene="ERP29" /gene_synonym="C12orf8" polyA_site 1916 /gene="ERP29" /gene_synonym="C12orf8" ORIGIN
cagccccactccctccgcgctccgccatggctgcggcggccgctgccggctcgctgctcctctgcttgctcggcttggcgctgcccggcagcgcgctgcacaccaagggctccgtgcccctcgacaccatcaccttttacaaggtgatcccaaagcataagtttgtccttgtgaagtttgatacgcagtacccttacggcgagaaacaagatgagttcaaaaagctggcagagagctcaggctccagtgaagatcttctggtggctgaagtgggaatatcagactatggtgataaactgaacactgagctgggagaaaagtacaagctggacaaggagaagtaccctatcttttatttgttccaggatggtgactttgacaatcccttaccttactctggccacattaaagccggggctattcagcgctggctgaagagtaatggcatctacctggggatgccgggctgtctgaaggagtatgatgtgctggccagcaagtttatgagtgtcactgacaagtcagaacgccagtccctcctgaagaaggggcagcagagcttagagaaagcaaaggagactgagaagaagtcagctgagcaatacttgaaaattatgagcaagatactggagcagggagaagagtttgctgctaacgaagttgtccgaatcacaaaactgattgagaagaacaaaatgagtgatggaaaaaaggaggagctccagaaaagcctcaatatcctcgcttctttcctaaagaagaataatgaaaaagatgagctctgatactctggggaactttgtgcaagctgtgaaacactgtcaagtcctaaccagttctcccagtgcaagcaaacttcccgctgacttcaagagagcagcagacgcccttgtatcctcagttataagatcaagaggaagcaatgcctcaaaaacacagtattctacgtgttgggaaaaacaccttaaagcaagctgccagtattgtgaaatactattaagtaacagtgttaaagtagaccaaaaaaatcactatgttggcctggagcacattcccggcagtttttacagctgttccctggcaaaccaatgacaaaattcagtctcacattccgtgtttccaaaggtacagaggtggtgcccctgccatgcccgcctgcccctggttttagtgctcttgggtttagttctgttcacccctcatcccaccctctttctccccggtagggttttctctgagtcctgtccttacctgctgctgctgctgaccgagagctgccgtttccttctgccttttccagcagttgttgggctggggttcaatctgcacatgagagcctgtcctgctgcagcagaacccctttgtggtacccggcagagcgaggtctgagtgctgaggtctcctccagcggcagttacactggggctcacccatttgtgcaaaaatgtgcttttttttccagtggcagattaaattcaggtgagttttcctatggctgaaggcacccgatgcttttttgacctgttcttcctgtccaaacttcacctcatgaataagagcaggaggcagaaagggacatttaaaagttccgagtggttgctaacatgaagaaaatgctttctcccagcctgatcttcagaatgacactgtgaaactaaagcttcagcagccctcggcagagttaaaactatttaaaaacgaggtcttgcgacaggaagaaaaagcgttaattcccttaaaagctctgtcagggtcacaaacaccttcacgtttcaccttgagactgtgctttctgctaagcaaattgatttctgtgggagctttgctgccttttgaatcctggggtggggatgaagagctgccagacgaaatgtattaatattgctctgatgataataaaaactggttccaacgaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]