GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 07:08:49, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001199393            1702 bp    mRNA    linear   VRT 24-SEP-2023
DEFINITION  Gallus gallus centrosomal protein 41 (CEP41), mRNA.
ACCESSION   NM_001199393 XM_414980
VERSION     NM_001199393.2
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1702)
  AUTHORS   Tang H, Finn RD and Thomas PD.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 1702)
  AUTHORS   Savolainen P, Fitzsimmons C, Arvestad L, Andersson L and Lundeberg
            J.
  TITLE     ESTs from brain and testis of White Leghorn and red junglefowl:
            annotation, bioinformatic classification of unknown transcripts and
            analysis of expression levels
  JOURNAL   Cytogenet Genome Res 111 (1), 79-87 (2005)
   PUBMED   16093725
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAENSK010000006.1.
            
            On Dec 3, 2021 this sequence version replaced NM_001199393.1.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: HAEK01023890.1, HAEK01046653.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992290 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-91                JAENSK010000006.1  590942-591032       c
            92-155              JAENSK010000006.1  590413-590476       c
            156-203             JAENSK010000006.1  589502-589549       c
            204-265             JAENSK010000006.1  586866-586927       c
            266-335             JAENSK010000006.1  586429-586498       c
            336-480             JAENSK010000006.1  585819-585963       c
            481-632             JAENSK010000006.1  585482-585633       c
            633-700             JAENSK010000006.1  585127-585194       c
            701-815             JAENSK010000006.1  584173-584287       c
            816-1031            JAENSK010000006.1  583777-583992       c
            1032-1702           JAENSK010000006.1  582708-583378       c
FEATURES             Location/Qualifiers
     source          1..1702
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="1"
                     /map="1"
     gene            1..1702
                     /gene="CEP41"
                     /gene_synonym="TSGA14"
                     /note="centrosomal protein 41"
                     /db_xref="CGNC:6138"
                     /db_xref="GeneID:416684"
     exon            1..91
                     /gene="CEP41"
                     /gene_synonym="TSGA14"
                     /inference="alignment:Splign:2.1.0"
     CDS             59..1162
                     /gene="CEP41"
                     /gene_synonym="TSGA14"
                     /note="testis specific, 14; centrosomal protein 41kDa"
                     /codon_start=1
                     /product="centrosomal protein of 41 kDa"
                     /protein_id="NP_001186322.2"
                     /db_xref="CGNC:6138"
                     /db_xref="GeneID:416684"
                     /translation="
MSSRRSVGDPEYLTRRIPQNPRYQHIKTRLDTGSSLTKYIEKLEEIKRNYRYRKDELFKRLKVTTFAQLVVQVASLSDETLEVTNEEIHKLEGGNSPASDADAELTAGTNGKGSPNGTPPSPVLFINNTGAGESYRSTLQSLISGVGELDIEKDTHKKADTQAKDTPYPDCPFLLLDVRDRDAYDQCHIVGAYSYPIAMLSRAMNPYTNSILEYKNAHGKIIILYDDDERLASQAATTMCERGFENLFMLSGGLKVLAQKVPEGLITGSLPISCQVAAPTGSARKKPVPKVPPTRAESKWRYSAEDLQKIKYYLEEEQLPSDTASRLSRGSSGRDSKATTARSSPSLPSTAGSRMLSRSSIQNRPWK"
     misc_feature    566..823
                     /gene="CEP41"
                     /gene_synonym="TSGA14"
                     /note="Rhodanese-like domain; Region: Rhodanese;
                     pfam00581"
                     /db_xref="CDD:425764"
     misc_feature    734..736
                     /gene="CEP41"
                     /gene_synonym="TSGA14"
                     /note="active site residue [active]"
                     /db_xref="CDD:238089"
     exon            92..155
                     /gene="CEP41"
                     /gene_synonym="TSGA14"
                     /inference="alignment:Splign:2.1.0"
     exon            156..203
                     /gene="CEP41"
                     /gene_synonym="TSGA14"
                     /inference="alignment:Splign:2.1.0"
     exon            204..265
                     /gene="CEP41"
                     /gene_synonym="TSGA14"
                     /inference="alignment:Splign:2.1.0"
     exon            266..335
                     /gene="CEP41"
                     /gene_synonym="TSGA14"
                     /inference="alignment:Splign:2.1.0"
     exon            336..480
                     /gene="CEP41"
                     /gene_synonym="TSGA14"
                     /inference="alignment:Splign:2.1.0"
     exon            481..632
                     /gene="CEP41"
                     /gene_synonym="TSGA14"
                     /inference="alignment:Splign:2.1.0"
     exon            633..700
                     /gene="CEP41"
                     /gene_synonym="TSGA14"
                     /inference="alignment:Splign:2.1.0"
     exon            701..815
                     /gene="CEP41"
                     /gene_synonym="TSGA14"
                     /inference="alignment:Splign:2.1.0"
     exon            816..1031
                     /gene="CEP41"
                     /gene_synonym="TSGA14"
                     /inference="alignment:Splign:2.1.0"
     exon            1032..1702
                     /gene="CEP41"
                     /gene_synonym="TSGA14"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
aggggcagacagagccggacggcgggaggcggcggagcgtgagaagcgttgtgggacgatgtcgagcaggaggagcgtcggtgaccccgagtacttaaccaggcgcatccctcagaacccccggtaccaacacatcaaaacccgcctcgataccgggagcagtctgacaaaatacattgagaagttggaggaaatcaaaagaaattacaggtacagaaaggacgagctgtttaaaagactgaaagtgactacttttgcccaactggttgttcaggttgcttctctgtctgatgaaaccttagaagtgacgaatgaggagatccacaagctggaaggtggcaattctcctgcttcagacgcagatgctgagctcacagcggggacaaatggcaaagggagccccaatgggacaccccccagtcctgtcctgttcataaacaacaccggagctggagaatcgtatcggtccacactgcagagtttgataagcggtgtcggtgaattggatatagaaaaggacactcataagaaagcagacacccaggcgaaggatactccttatcctgactgccccttcctgctgttagacgtacgagaccgcgatgcttacgaccagtgtcacatagttggagcttattcttatcctattgcaatgctgtctagagccatgaatccatatacaaacagtattctggaatataaaaatgcccatggaaagattataattctgtacgacgacgacgagcggctcgccagccaggctgccaccaccatgtgtgagaggggctttgagaacttgttcatgttgtctggagggctcaaggtgcttgcacagaaggtcccggaaggactcatcaccggctcgctccccatttcctgccaggtggcagctcccacagggtctgcccgaaaaaagcctgttcccaaagtgccacccacgcgtgctgagagcaaatggaggtactctgcagaagatctgcagaagattaagtactacctcgaagaggagcagcttccttcagacactgccagtcgccttagccgtggctcttcgggacgtgattccaaagcaacaacagcacggagcagccccagcctccccagcacagcgggatcccgcatgctcagcaggagcagcatccagaacaggccatggaaataagcagctgtgtctccttccactgaataaatgagcgtccaggttctgggaaccctgagcagtgcagccctgtttgtcattttaggaattcacggaggaaagcggtggtgatgtataaatggcagcttgggtaaggctggggagacggaagggttgatgtgatgtcttgtaggagcagtgtcacgttggccaagtgaccttcaggacaggtttttgtaggggaggggggaaaactggtagtgaagcctgtgaccaagtagcaatggatctgaaagacctgcagttcagactaaggaattgtgtctgtagcaaaccttcctctgtgctgggctcagagctgcaggctgtgctaacagtgagaagaaattgatcagaaaattgtgagcagaaaccgtggcgttctgtggcagggatggacattcagcaaattgccaaaatggtggagagagaggattccaaatctctcttttttttttttttatttatgttaacgagcagaagtgtttgtaataaagatgttttgggaaataacgaccagcgtgg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]