ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-01-18 21:19:06, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_076189006 671 bp mRNA linear INV 12-AUG-2025
DEFINITION PREDICTED: Oratosquilla oratoria metallo-beta-lactamase
domain-containing protein 1-like (LOC143027628), transcript variant
X4, mRNA.
ACCESSION XM_076189006
VERSION XM_076189006.1
DBLINK BioProject: PRJNA1302514
KEYWORDS RefSeq.
SOURCE Oratosquilla oratoria
ORGANISM Oratosquilla oratoria
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea;
Multicrustacea; Malacostraca; Eumalacostraca; Hoplocarida;
Stomatopoda; Squillidae; Oratosquilla.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NC_134784) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI RefSeq
Annotation Status :: Full annotation
Annotation Name :: GCF_046742065.1-RS_2025_08
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 10.4
Annotation Method :: Gnomon; cmsearch; tRNAscan-SE
Features Annotated :: Gene; mRNA; CDS; ncRNA
Annotation Date :: 08/08/2025
##Genome-Annotation-Data-END##
FEATURES Location/Qualifiers
source 1..671
/organism="Oratosquilla oratoria"
/mol_type="mRNA"
/isolate="Oo_2021"
/isolation_source="ocean"
/db_xref="taxon:337810"
/chromosome="8"
/tissue_type="muscle"
/geo_loc_name="China"
/collection_date="2021-01"
gene 1..671
/gene="LOC143027628"
/note="metallo-beta-lactamase domain-containing protein
1-like; Derived by automated computational analysis using
gene prediction method: Gnomon. Supporting evidence
includes similarity to: 100% coverage of the annotated
genomic feature by RNAseq alignments, including 10 samples
with support for all annotated introns"
/db_xref="GeneID:143027628"
CDS 111..656
/gene="LOC143027628"
/codon_start=1
/product="metallo-beta-lactamase domain-containing protein
1-like isoform X4"
/protein_id="XP_076045121.1"
/db_xref="GeneID:143027628"
/translation="
MEKFKYAQLGVASHGLNCDDIGYAIATHGHSDHLGNLNLFLKAKHIVGFTISYQHEFFIHPFETGEPYKIDENVEVLPTPGHTTADVSVVVRTQDMGTVVVAGEKRPNGSNIEAKEDKTCLLVKASLASELEPFEEDSNSEEVISSENDCVAPEPTSLRPSRKTAPSSRDQVRSLALKRLL"
ORIGIN
aaaaagtgaagtgtactgcttgattatttattttcttgattccttagaactgaaatgaattgacaatattgtttgtagaagaagtaagaacactagtaaaatgaaatagcatggaaaaattcaaatatgcacaattaggtgtggcatcacatggcttgaactgtgatgacattggatatgccatagcaacccatggccactcagaccacctagggaatctcaatctcttcttgaaggcaaagcacattgtaggattcaccatatcttaccagcatgagttcttcattcatccctttgaaacaggtgaaccatacaagatagacgagaatgtggaagtgctcccaacaccaggtcacaccacagctgatgtaagtgtggttgttcgaacccaggacatgggtactgtggttgtagctggagaaaaaagacctaacggatcaaatatagaagccaaagaagacaaaacttgccttttggttaaggcatctctggctagcgagttggagccctttgaagaggactcaaactcggaggaggttatttcttcggaaaacgactgtgtcgctccagaacctacctctttgagaccttctcgtaagactgcgccatcctctagggaccaagtaagatctctagctcttaaaaggttattgtaaattttcctcgaaagt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]