LOCUS       XM_072115442            1623 bp    mRNA    linear   VRT 14-MAR-2025
DEFINITION  PREDICTED: Engystomops pustulosus Meis homeobox 2 (MEIS2),
            transcript variant X5, mRNA.
ACCESSION   XM_072115442
VERSION     XM_072115442.1
DBLINK      BioProject: PRJNA1226277
KEYWORDS    RefSeq.
SOURCE      Engystomops pustulosus (Tungara frog)
  ORGANISM  Engystomops pustulosus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Neobatrachia; Hyloidea;
            Leptodactylidae; Leiuperinae; Engystomops.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_092417) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_040894005.1-RS_2025_03
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 03/12/2025
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1623
                     /organism="Engystomops pustulosus"
                     /mol_type="mRNA"
                     /db_xref="taxon:76066"
                     /chromosome="7"
     gene            1..1623
                     /gene="MEIS2"
                     /note="Meis homeobox 2; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 Protein"
                     /db_xref="GeneID:140069583"
     CDS             258..1448
                     /gene="MEIS2"
                     /codon_start=1
                     /product="homeobox protein Meis2 isoform X5"
                     /protein_id="XP_071971543.1"
                     /db_xref="GeneID:140069583"
                     /translation="

MSSKDPAHASMFLYDELPHYAMDGVGVPTSMYGDPHAPRPIPPVHHLNHGPPLHASQHYGTHAPHPNVMPTSMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPASWRDHDDAVSTHSAGTPGPSSGGHASQSGDNSSEQGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM"

     misc_feature    609..863
                     /gene="MEIS2"
                     /note="N-terminal of Homeobox Meis and PKNOX1; Region:
                     Meis_PKNOX_N; pfam16493"
                     /db_xref="CDD:465140"
     misc_feature    1125..1241
                     /gene="MEIS2"
                     /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920"
                     /db_xref="CDD:428673"
ORIGIN      

tctgacactctcttgcactctctctctgtgacacacacctctctctctccctctctctccctctctctttctctctttcactagtcagtctcctcatctccctctgccctgcttcctccttctccaacatatttaccctctatcaataactattctctaccccttttcctctccttcttctaacattttttctccttagaggttgcacttctctttttcttatttttttgggggggattttttggatatttttttggatgagcagtaaagaccccgcacacgcctcaatgttcctgtacgatgagttaccgcactatgccatggatggagtgggggtgccaacttctatgtatggtgacccacatgcccctcgacctatccctccggtacaccacttaaaccatggaccccctttacatgccagccagcactatggaactcatgcccctcatccaaatgttatgcccaccagcatgggatctgctgtgaacgatgccctcaaacgggacaaagatgccatttatggacaccccctcttccctcttctagccctggtctttgagaagtgtgaactggcgacgtgtaccccccgggagcctggagtcgcaggaggggatgtgtgctcctcggactcctttaatgaagacatcgctgtatttgcaaaacaggttcgtgcagagaagccacttttctcctccaaccccgagctggacaatctgatgatccaggcgatccaggtcctgcggtttcatctcttggaattagaaaaggtccatgaattgtgtgataatttctgccatcgatacatcagctgtttgaaaggaaaaatgcccatagatttagtgattgatgagagggatggaagctccaagtctgaccatgaagaactatctggatcctccacaaaccttgcagaccataatccagcctcatggagagaccacgatgacgcagtatctacgcattcagcgggcacgccgggaccctccagtggtgggcacgcgtcacagagtggggacaacagcagtgaacaaggagacgatgatgacccagacaaggacaaaaagagacaaaagaaaagaggcatattccccaaagtagcaacgaatattatgagggcgtggctattccaacatctcacgcatccatacccttcagaagaacagaagaaacagttagcacaggacacagggctgactatattgcaagtaaataactggttcattaacgccaggagacgaatagtccagccgatgattgaccagtctaatcgagcaggttttcttcttgatccttcagtgagccaaggagcagcgtatagtccagaagggcaacctatgggaagctttgtattggatgggcagcaacatatggggatccgacctgcaggtcctatgagtggaatgggcatgaatatgggcatggatgggcagtggcactatatgtaaccaacacattgcagagcaatcaaagcaaggggaagtctgcagtacatgccaggggactgtctttctcagggtggtcctacgagtatcagtttggtacaaccagctcacacttttccccagttggcatcacacccttcctcaagacatggaccaccagggcccgacatccaccatc

//