GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-09-16 20:27:04, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       XM_071427011            1477 bp    mRNA    linear   VRT 15-FEB-2025
DEFINITION  PREDICTED: Agelaius tricolor Meis homeobox 2 (MEIS2), transcript
            variant X7, mRNA.
ACCESSION   XM_071427011
VERSION     XM_071427011.1
DBLINK      BioProject: PRJNA1221961
KEYWORDS    RefSeq.
SOURCE      Agelaius tricolor (tricolored blackbird)
  ORGANISM  Agelaius tricolor
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Neoaves; Telluraves; Australaves;
            Passeriformes; Passeroidea; Icteridae; Agelaius.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_027269265) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_023055355.1-RS_2025_02
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 02/12/2025
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1477
                     /organism="Agelaius tricolor"
                     /mol_type="mRNA"
                     /isolate="1412-34295"
                     /db_xref="taxon:9191"
                     /chromosome="Unknown"
                     /sex="female"
                     /tissue_type="blood"
                     /dev_stage="adult"
                     /lat_lon="36.4692 N 121.7914 W"
     gene            1..1477
                     /gene="MEIS2"
                     /note="Meis homeobox 2; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 Protein"
                     /db_xref="GeneID:139590012"
     CDS             431..1462
                     /gene="MEIS2"
                     /codon_start=1
                     /product="homeobox protein Meis2 isoform X7"
                     /protein_id="XP_071283112.1"
                     /db_xref="GeneID:139590012"
                     /translation="
MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHAGQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWCVYAPGLLATVHSIYRS"
     misc_feature    758..1012
                     /gene="MEIS2"
                     /note="N-terminal of Homeobox Meis and PKNOX1; Region:
                     Meis_PKNOX_N; pfam16493"
                     /db_xref="CDD:465140"
     misc_feature    1313..>1408
                     /gene="MEIS2"
                     /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920"
                     /db_xref="CDD:428673"
ORIGIN      
gcccggggccgcaccggctccgcgcgccccccccgcgcgctgtagctcccggtgcccggggctcgcgcaccgcgcgcggcagcggccggagccgccgacccgagccagcggccccgcgcgccgccagacgccccacgccgcgggtaatcggaagagaaagaaaaaaagaaaaagagagacagaaaaaggaaagagaaagagacagaaaaaaagaagaaaacagaaactcatcgtggttcttgactgttttttatatattgttgttgttattgttgttgttattactattatttacccatattggaggataggagaagtctataagtgggttgcaaaaaaaaaggaatcttcttcactctaaatcactttctttgctggactgggatattaaatatacgacacatccaggagtttattggagcgcagactgatggcgcaaaggtacgatgagctgccccactacggcgggatggacggagtaggggtgccggcgtccatgtacggggacccccacgccccccggccgatccccccggtgcaccacctcaaccatgggccgccgctccacgccggacagcactacggcgcccacgccccgcaccccaatgtcatgccggccagcatgggctccgctgtcaacgacgccctgaaacgggacaaggatgcgatctacgggcacccgttgttccccctcttagctctggtctttgagaagtgcgagctggcgacctgcacgccccgggagcccggcgtggccggcggggacgtctgctcctccgactccttcaacgaggacatcgccgtcttcgctaaacaggtccgcgccgaaaagccacttttttcgtcaaatccagagttggacaatttgatgatccaagcaatacaagtactaaggtttcatcttttggaattagaaaaggttcatgaattgtgtgataatttctgccatcggtacattagttgtttgaaaggaaaaatgccaatagacctcgttattgatgaaagggatggcagctccaaatcagaccatgaagaactctcaggatcttccacaaatttagccgatcataatccttcatcttggagagaccacgatgatgcaacctcaacgcactcggcaggcacaccagggccctccagcgggggccacgcttcccagagtggagacaacagcagcgagcaaggtgatggtttagacaacagtgtagcctcacctggtacaggagatgatgatgacccagacaaggacaaaaagcgtcagaagaaaagaggcattttccccaaagtagcaacaaatatcatgagagcgtggcttttccagcatctcacacatccatatccttcagaggagcagaagaaacagttagcccaagacacgggacttacaattctacaagtaaacaactggtgtgtttatgccccaggcttgctggccacagtccattccatttacagaagctgaattaaacaataacta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]