LOCUS       NM_117704               2666 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana response regulator 2 (RR2), mRNA.
ACCESSION   NM_117704
VERSION     NM_117704.6
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 2666)
  AUTHORS   Mayer,K., Schuller,C., Wambutt,R., Murphy,G., Volckaert,G.,
            Pohl,T., Dusterhoft,A., Stiekema,W., Entian,K.D., Terryn,N.,
            Harris,B., Ansorge,W., Brandt,P., Grivell,L., Rieger,M.,
            Weichselgartner,M., de Simone,V., Obermaier,B., Mache,R.,
            Muller,M., Kreis,M., Delseny,M., Puigdomenech,P., Watson,M.,
            Schmidtheini,T., Reichert,B., Portatelle,D., Perez-Alonso,M.,
            Boutry,M., Bancroft,I., Vos,P., Hoheisel,J., Zimmermann,W.,
            Wedler,H., Ridley,P., Langham,S.A., McCullagh,B., Bilham,L.,
            Robben,J., Van der Schueren,J., Grymonprez,B., Chuang,Y.J.,
            Vandenbussche,F., Braeken,M., Weltjens,I., Voet,M., Bastiaens,I.,
            Aert,R., Defoor,E., Weitzenegger,T., Bothe,G., Ramsperger,U.,
            Hilbert,H., Braun,M., Holzer,E., Brandt,A., Peters,S., van
            Staveren,M., Dirske,W., Mooijman,P., Klein Lankhorst,R., Rose,M.,
            Hauf,J., Kotter,P., Berneiser,S., Hempel,S., Feldpausch,M.,
            Lamberth,S., Van den Daele,H., De Keyser,A., Buysshaert,C.,
            Gielen,J., Villarroel,R., De Clercq,R., Van Montagu,M., Rogers,J.,
            Cronin,A., Quail,M., Bray-Allen,S., Clark,L., Doggett,J., Hall,S.,
            Kay,M., Lennard,N., McLay,K., Mayes,R., Pettett,A.,
            Rajandream,M.A., Lyne,M., Benes,V., Rechmann,S., Borkova,D.,
            Blocker,H., Scharfe,M., Grimm,M., Lohnert,T.H., Dose,S., de
            Haan,M., Maarse,A., Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M.,
            Fartmann,B., Granderath,K., Dauner,D., Herzl,A., Neumann,S.,
            Argiriou,A., Vitale,D., Liguori,R., Piravandi,E., Massenet,O.,
            Quigley,F., Clabauld,G., Mundlein,A., Felber,R., Schnabl,S.,
            Hiller,R., Schmidt,W., Lecharny,A., Aubourg,S., Chefdor,F.,
            Cooke,R., Berger,C., Montfort,A., Casacuberta,E., Gibbons,T.,
            Weber,N., Vandenbol,M., Bargues,M., Terol,J., Torres,A.,
            Perez-Perez,A., Purnelle,B., Bent,E., Johnson,S., Tacon,D.,
            Jesse,T., Heijnen,L., Schwarz,S., Scholler,P., Heber,S., Francs,P.,
            Bielke,C., Frishman,D., Haase,D., Lemcke,K., Mewes,H.W.,
            Stocker,S., Zaccaria,P., Bevan,M., Wilson,R.K., de la Bastide,M.,
            Habermann,K., Parnell,L., Dedhia,N., Gnoj,L., Schutz,K., Huang,E.,
            Spiegel,L., Sehkon,M., Murray,J., Sheet,P., Cordes,M.,
            Abu-Threideh,J., Stoneking,T., Kalicki,J., Graves,T., Harmon,G.,
            Edwards,J., Latreille,P., Courtney,L., Cloud,J., Abbott,A.,
            Scott,K., Johnson,D., Minx,P., Bentley,D., Fulton,B., Miller,N.,
            Greco,T., Kemp,K., Kramer,J., Fulton,L., Mardis,E., Dante,M.,
            Pepin,K., Hillier,L., Nelson,J., Spieth,J., Ryan,E., Andrews,S.,
            Geisel,C., Layman,D., Du,H., Ali,J., Berghoff,A., Jones,K.,
            Drone,K., Cotton,M., Joshu,C., Antonoiu,B., Zidanic,M., Strong,C.,
            Sun,H., Lamar,B., Yordan,C., Ma,P., Zhong,J., Preston,R., Vil,D.,
            Shekher,M., Matero,A., Shah,R., Swaby,I.K., O'Shaughnessy,A.,
            Rodriguez,M., Hoffmann,J., Till,S., Granat,S., Shohdy,N.,
            Hasegawa,A., Hameed,A., Lodhi,M., Johnson,A., Chen,E., Marra,M.,
            Martienssen,R. and McCombie,W.R.
  TITLE     Sequence and analysis of chromosome 4 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 402 (6763), 769-777 (1999)
   PUBMED   10617198
REFERENCE   2  (bases 1 to 2666)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2666)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 2666)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003075).
            
            On May 26, 2011 this sequence version replaced NM_117704.5.
FEATURES             Location/Qualifiers
     source          1..2666
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="4"
                     /ecotype="Columbia"
     gene            1..2666
                     /gene="RR2"
                     /locus_tag="AT4G16110"
                     /gene_synonym="ARR2; DL4095W; FCAALL.287; response
                     regulator 2"
                     /note="Encodes a pollen-specific transcription factor
                     involved in the expression of nuclear genes for components
                     of mitochondrial complex I in Arabidopsis. Acts in concert
                     with other type-B ARRs in the cytokinin signaling pathway.
                     AHK3 mediates cytokinin-induced phosphorylation of ARR2 on
                     the Asp-80 residue. This phosphorylation plays a positive
                     role of ARR2 in cytokinin-mediated control of leaf
                     longevity. Also involved in cytokinin-dependent inhibition
                     of hypocotyl elongation."
                     /db_xref="Araport:AT4G16110"
                     /db_xref="GeneID:827297"
                     /db_xref="TAIR:AT4G16110"
     CDS             294..2287
                     /gene="RR2"
                     /locus_tag="AT4G16110"
                     /gene_synonym="ARR2; DL4095W; FCAALL.287; response
                     regulator 2"
                     /inference="similar to RNA sequence,
                     EST:INSD:BP823280.1,INSD:BX834157.1,INSD:BX834807.1,
                     INSD:EL228552.1,INSD:CK120302.1,INSD:BP850696.1,
                     INSD:EH798703.1,INSD:EL124644.1,INSD:EG457709.1,
                     INSD:AV808217.1,INSD:BX836909.1,INSD:EL335000.1,
                     INSD:EG445869.1,INSD:BX837965.1,INSD:BP839859.1,
                     INSD:EL002891.1,INSD:EL179267.1,INSD:BP793034.1,
                     INSD:BP867693.1,INSD:W43636.1,INSD:EL042379.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:DQ473519.1,INSD:AK175378.1,INSD:AK175959.1,
                     INSD:AK176614.1,INSD:AK175737.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="response regulator 2 (RR2); CONTAINS InterPro
                     DOMAIN/s: Response regulator, plant B-type
                     (InterPro:IPR017053), Myb-like DNA-binding domain, SHAQKYF
                     class (InterPro:IPR006447), CheY-like
                     (InterPro:IPR011006), Homeodomain-like
                     (InterPro:IPR009057), Myb, DNA-binding
                     (InterPro:IPR014778), Signal transduction response
                     regulator, receiver domain (InterPro:IPR001789), HTH
                     transcriptional regulator, Myb-type, DNA-binding
                     (InterPro:IPR017930), Homeodomain-related
                     (InterPro:IPR012287); BEST Arabidopsis thaliana protein
                     match is: response regulator 1 (TAIR:AT3G16857.2); Has
                     95443 Blast hits to 94483 proteins in 2985 species: Archae
                     - 623; Bacteria - 84652; Metazoa - 47; Fungi - 382; Plants
                     - 2721; Viruses - 2; Other Eukaryotes - 7016 (source: NCBI
                     BLink)."
                     /codon_start=1
                     /product="response regulator 2"
                     /protein_id="NP_193346.5"
                     /db_xref="GeneID:827297"
                     /db_xref="TAIR:AT4G16110"
                     /db_xref="Araport:AT4G16110"
                     /translation="

MVNPGHGRGPDSGTAAGGSNSDPFPANLRVLVVDDDPTCLMILERMLMTCLYRVTKCNRAESALSLLRKNKNGFDIVISDVHMPDMDGFKLLEHVGLEMDLPVIMMSADDSKSVVLKGVTHGAVDYLIKPVRIEALKNIWQHVVRKKRNEWNVSEHSGGSIEDTGGDRDRQQQHREDADNNSSSVNEGNGRSSRKRKEEEVDDQGDDKEDSSSLKKPRVVWSVELHQQFVAAVNQLGVDKAVPKKILEMMNVPGXTRENVASHLQKYRIYLRRLGGVSQHQGNMNHSFMTGQDQSFGPLSSLNGFDLQSLAVTGQLPPQSLAQLQAAGLGRPTLAKPGMSVSPLVDQRSIFNFENPKIRFGDGHGQTMNNGNLLHGVPTGSHMRLRPGQNVQSSGMMLPVADQLPRGGPSMLPSLGQQPILSSSVSRRSDLTGALAVRNSIPETNSRVLPTTHSVFNNFPADLPRSSFPLASAPGISVPVSVSYQEEVNSSDAKGGSSAATAGFGNPSYDIFNDFPQHQQHNKNISNKLNDWDLRNMGLVFSSNQDAATATATAAFSTSEAYSSSSTQRKRRETDATVVGEHGQNLQSPSRNLYHLNHVFMDGGSVRVKSERVAETVTCPPANTLFHEQYNQEDLMSAFLKQEGIPSVDNEFEFDGYSIDNIQV"

     misc_feature    381..725
                     /gene="RR2"
                     /locus_tag="AT4G16110"
                     /gene_synonym="ARR2; DL4095W; FCAALL.287; response
                     regulator 2"
                     /note="phosphoacceptor receiver (REC) domain of type B
                     Arabidopsis response regulators (ARRs) and similar
                     domains; Region: REC_typeB_ARR-like; cd17584"
                     /db_xref="CDD:381121"
     misc_feature    939..1100
                     /gene="RR2"
                     /locus_tag="AT4G16110"
                     /gene_synonym="ARR2; DL4095W; FCAALL.287; response
                     regulator 2"
                     /note="myb-like DNA-binding domain, SHAQKYF class; Region:
                     myb_SHAQKYF; TIGR01557"
                     /db_xref="CDD:130620"
ORIGIN      

acttcaaaaaaagaaatgtaacagagaaatccgagctttcaagctgtgaaacaatagccatgcccttcataaatctttctactaattattttttttcacgtaagattctcaaaacaaatcaaaatctcatcttcttggtatcaaaaattttcttactttttttggttttgttatcccgaatttttagaatcaaaacccacgtcaattctttttcaaaggcatatattctctctgtttcaaactttgtgtctcttcttctccttctctgatcgttcgttttctggacgagagagatggtaaatccgggtcacggaagaggacccgattcgggtactgctgctggtgggtcaaactccgacccgtttcctgcgaatcttcgagttcttgtcgttgatgatgatccaacttgtctcatgatcttagagaggatgcttatgacttgtctctacagagtaactaaatgtaacagagcagagagcgcattgtctctgcttcggaagaacaagaatggttttgatattgtcattagtgatgttcatatgcctgacatggatggtttcaagctccttgaacacgttggtttagagatggatttacctgttatcatgatgtctgcggatgattcgaagagcgttgtgttgaaaggagtgactcacggtgcagttgattacctcatcaaaccggtacgtattgaggctttgaagaatatatggcaacatgtggtgcggaagaagcgtaacgagtggaatgtttctgaacattctggaggaagtattgaagatactggcggtgacagggacaggcagcagcagcatagggaggatgctgataacaactcgtcttcagttaatgaagggaacgggaggagctcgaggaagcggaaggaagaggaagtagatgatcaaggggatgataaggaagactcatcgagtttaaagaaaccacgcgtggtttggtctgttgaattgcatcagcagtttgttgctgctgtgaatcagctaggcgttgacaaagctgttcctaagaagatcttagagatgatgaatgtacccggctaacgcgagaaaacgtagccagtcacctccagaagtatcggatatatctgagacggcttggaggagtatcgcaacaccaaggaaatatgaaccattcgtttatgactggtcaagatcagagttttggacctctttcttcgttgaatggatttgatcttcaatctttagctgttactggtcagctccctcctcagagccttgcacagcttcaagcagctggtcttggccggcctacactcgctaaaccagggatgtcggtttctccccttgtagatcagagaagcatcttcaactttgaaaacccaaaaataagatttggagacggacatggtcagacgatgaacaatggaaatttgcttcatggtgtcccaacgggtagtcacatgcgtctgcgtcctggacagaatgttcagagcagcggaatgatgttgccagtagcagaccagctacctcgaggaggaccatcgatgctaccatccctcgggcaacagccgatattgtcaagcagcgtttcaagaagaagcgatctcactggtgcgctggcggttagaaacagtatccccgagaccaacagcagagtgttaccaactactcactcggtcttcaataacttccccgcggatctacctcgcagcagcttcccgttggcaagtgccccagggatttcagttccagtatcagtttcttaccaagaagaggtcaacagctcggatgcaaaaggaggttcatcagctgctactgctggatttggtaacccaagctacgacatatttaacgattttccgcagcaccaacagcacaacaagaacatcagcaataaactaaacgattgggatctgcggaatatgggattggtcttcagttccaatcaggacgcagcaactgcaaccgcaaccgcagcattttccacttcggaagcatactcttcgtcttctacgcagagaaaaagacgggaaacggacgcaacagttgtgggtgagcatgggcagaacctgcagtcaccgagccggaatctgtatcatctgaaccacgtttttatggacggtggttcagtcagagtgaagtcagaaagagtggcggagacagtgacttgtcctccagcaaatacattgtttcacgagcagtataatcaagaagatctgatgagcgcatttctcaaacaggaaggcatcccatccgtagataacgagttcgaatttgacggatactccatcgataatatccaggtctgactacagaaactcagactagactgcaagattctttgtttttcttctccctccttcgaggtacaaagctcaaaacatggcaataaccgaagggaaagatagaaacgatcatgtgttgtatctttagatgataatctgcaggaaattccaaaagcaggttttagaagacaataattgttttctttttggttattaggagtaatgtgaatttccttgtttctacatctgtctaggtcttacaacaagactcttgacatttagggttcttgatcgtctaatttcctataattagaaatgttttgcttctctctttttgagttttaggaacattttgtgtaaatatgtttctatgcgttgttgcttcataataataaagatacgg

//