ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-01-19 00:17:50, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_001085685 742 bp mRNA linear VRT 02-APR-2025 DEFINITION Xenopus laevis NK3 homeobox 2 S homeolog (nkx3-3.S), mRNA. ACCESSION NM_001085685 VERSION NM_001085685.1 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus. REFERENCE 1 (bases 1 to 742) AUTHORS Newman,C.S. and Krieg,P.A. TITLE The Xenopus bagpipe-related homeobox gene zampogna is expressed in the pharyngeal endoderm and the visceral musculature of the midgut JOURNAL Dev Genes Evol 209 (2), 132-134 (1999) PUBMED 10022957 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AF095721.1. ##Evidence-Data-START## Transcript exon combination :: AF095721.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMD00012420, SAMN04111061 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..742 /organism="Xenopus laevis" /mol_type="mRNA" /db_xref="taxon:8355" /chromosome="7S" /map="7S" gene 1..742 /gene="nkx3-3.S" /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax; zax-A" /note="NK3 homeobox 2 S homeolog" /db_xref="GeneID:373704" /db_xref="Xenbase:XB-GENE-865322" CDS 68..742 /gene="nkx3-3.S" /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax; zax-A" /note="homeodomain protein zampogna; xzax; bagpipe homeobox; NK3 homeobox 2 L homeolog" /codon_start=1 /product="homeobox protein zampogna" /protein_id="NP_001079154.1" /db_xref="GeneID:373704" /db_xref="Xenbase:XB-GENE-865322" /translation="
MSLTSFSIQDILARTGGNRGKDTRTDGNNISPPPSPSADEGHNEWPRAENPPLTPEKEKTDTDSGTEDFHWERDTETANNGAFTDPSSGDRLADSPKSSKKRSRAAFSHAQVYELERRFSLQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRKLIATQTAPKSSLVPTRKVAVRVLVKDDQRQYCPEDMLSPSLLSLYHAYQYYPYMYCLPAWVPHLPL"
misc_feature 68..388
/gene="nkx3-3.S"
/gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax;
zax-A"
/note="propagated from UniProtKB/Swiss-Prot (O93590.1);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
misc_feature 368..538
/gene="nkx3-3.S"
/gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax;
zax-A"
/note="Region: Homeodomain; pfam00046"
/db_xref="CDD:459649"
ORIGIN
ggcacgagcgcagcctttctcccggccattggatacttctcccggccattggatactatgcactaacatgtccctcacctccttctccattcaagatatccttgcgcggaccggaggcaataggggcaaagacacnagaactgatgggaataatatctctccgccgccctctcccagcgctgatgaggggcacaatgaatggccgcgggcggagaacccgccactgactccggagaaagagaaaacggacacagactcagggacagaggacttccactgggagcgggacacagaaacagccaacaatggtgcttttacagatccttcttctggggacagactggcagacagccccaagtccagtaagaagaggtctcgggctgctttttctcatgctcaggtttatgaactggagaggaggttcagcctgcagcggtacctctctgggcctgaaagggcagacctggcagcttctctcaaactcacagagacccaagtaaagatttggtttcagaaccggcggtacaagaccaagaggaagctgattgccacccagacagcaccaaagtcctctcttgttccaaccagaaaggtggcagtcagggtgctggtaaaggatgaccagagacaatattgccctgaggatatgctgagcccatcccttctctctttataccatgcataccagtattatccatacatgtactgtctgccagcctgggtaccccaccttccactttga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]