2024-05-18 20:13:31, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_039090545 1265 bp mRNA linear ROD 11-JUN-2023 DEFINITION PREDICTED: Rattus norvegicus EF-hand calcium binding domain 2 (Efcab2), transcript variant X13, mRNA. ACCESSION XM_039090545 VERSION XM_039090545.1 DBLINK BioProject: PRJNA677964 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_051348.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_015227675.2-RS_2023_06 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 06/06/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1265 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN/NHsdMcwi" /db_xref="taxon:10116" /chromosome="13" /sex="male" /tissue_type="kidney" /country="USA: Wisconsin, Milwaukee, Medical College of Wisconsin" /collection_date="2019-03-08" /collected_by="Rebecca Schilling" gene 1..1265 /gene="Efcab2" /gene_synonym="RGD1308593" /note="EF-hand calcium binding domain 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 ESTs, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 38 samples with support for all annotated introns" /db_xref="GeneID:289280" /db_xref="RGD:1308593" CDS 403..852 /gene="Efcab2" /gene_synonym="RGD1308593" /codon_start=1 /product="dynein regulatory complex protein 8 isoform X10" /protein_id="XP_038946473.1" /db_xref="GeneID:289280" /db_xref="RGD:1308593" /translation="
MAEEKDPESTEAIVAELHKKIKEAFEVFDHESNNTVDVREIGTIIRSLGCSPTEGELHDFIAEVEEEEPTGYIRFEKFIPVMTTVLLEKRYRPIAEDVLLRAFEVLDPTKRGFLTKDELVKYMTEEGVLFPWRLPLELELHGQSIQVFP"
misc_feature 466..>783 /gene="Efcab2" /gene_synonym="RGD1308593" /note="calmodulin; Provisional; Region: PTZ00184" /db_xref="CDD:185504" ORIGIN
gcttaggagagggtgacgcgggagagcacaaggcctggtggggtaggggtgggcggaggcttttcggggaaggaccgcggaacgtgcaggggccgccaggtctgcaccgggttctgaggcgcacctgacacggcgaaaaaaaagctaaataaaataagtaattaaataagtgaataaataaacaaacaaggcaccctacgtccttgacagtcgcaaccaggccaaggccggctcggggccttattaataaatgactcccctaggcccaaagaacgccggcctcagttcttggggggttgggagacggccaccgcgcgtcgaggggcttcctccgcctcgtccccctcgcgcggcccgcagggtttgtgatgggatctcccaggcgacgggctccgcaccaagatggcggaggaaaaggacccggagagtacagaggcaatagtggcagaacttcataagaagatcaaagaggcgtttgaagtgtttgaccatgaatcgaataatacagtagatgtgagagagattgggacgattatcaggtcgttaggatgcagccccactgaaggagaactgcacgatttcattgctgaggtagaggaagaagaacccactgggtacattcgatttgaaaaatttattccagtgatgaccacagtacttctagaaaaaagatacagaccaattgctgaagatgtccttttgcgagctttcgaggttttggatccaactaaacgtgggtttctgactaaggatgaactagtcaagtacatgactgaggaaggagtgttgttcccatggaggctccctctggagctggagttacatggtcagtctatccaagtgtttccctgactgtaagtggcttggtgggcagtcattactgcctgtgggcaccctgtcactcttgcagttagagaggagttctgcttcctctgctcagctcccagatgctcagccagatctgtcacatgtcacctgagaacatgggcatgggtggcattttgagccaggggagcagtattgatgctctatgtatgcctgctttggccattttgcctcagtttacctacaggaaggagagaaggagtaatatgacagtcatggctgccatccaggatggcatacagtgttaacatcatctaagcagctaacttcagtgagtgtgttatgacttccaaatcctaaggatgaacagaagtaagccctaaattatattgggtcacataaaattaataaaaacagccaaagaggctcagtcctcctac
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]