2024-05-18 21:56:09, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001399003 1115 bp mRNA linear ROD 22-MAR-2023 DEFINITION Rattus norvegicus mitochondrial ribosomal protein L15 (Mrpl15), transcript variant 1, mRNA; nuclear gene for mitochondrial product. ACCESSION NM_001399003 XM_006237805 VERSION NM_001399003.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1115) AUTHORS Brown A, Rathore S, Kimanius D, Aibara S, Bai XC, Rorbach J, Amunts A and Ramakrishnan V. TITLE Structures of the human mitochondrial ribosome in native states of assembly JOURNAL Nat Struct Mol Biol 24 (10), 866-869 (2017) PUBMED 28892042 REFERENCE 2 (bases 1 to 1115) AUTHORS Brown A, Amunts A, Bai XC, Sugimoto Y, Edwards PC, Murshudov G, Scheres SHW and Ramakrishnan V. TITLE Structure of the large ribosomal subunit from human mitochondria JOURNAL Science 346 (6210), 718-722 (2014) PUBMED 25278503 REFERENCE 3 (bases 1 to 1115) AUTHORS Baltz AG, Munschauer M, Schwanhausser B, Vasile A, Murakawa Y, Schueler M, Youngs N, Penfold-Brown D, Drew K, Milek M, Wyler E, Bonneau R, Selbach M, Dieterich C and Landthaler M. TITLE The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts JOURNAL Mol Cell 46 (5), 674-690 (2012) PUBMED 22681889 REFERENCE 4 (bases 1 to 1115) AUTHORS Castello A, Fischer B, Eichelbaum K, Horos R, Beckmann BM, Strein C, Davey NE, Humphreys DT, Preiss T, Steinmetz LM, Krijgsveld J and Hentze MW. TITLE Insights into RNA biology from an atlas of mammalian mRNA-binding proteins JOURNAL Cell 149 (6), 1393-1406 (2012) PUBMED 22658674 REFERENCE 5 (bases 1 to 1115) AUTHORS Tarantino C, Paolella G, Cozzuto L, Minopoli G, Pastore L, Parisi S and Russo T. TITLE miRNA 34a, 100, and 137 modulate differentiation of mouse embryonic stem cells JOURNAL FASEB J 24 (9), 3255-3263 (2010) PUBMED 20439489 REFERENCE 6 (bases 1 to 1115) AUTHORS Mootha VK, Bunkenborg J, Olsen JV, Hjerrild M, Wisniewski JR, Stahl E, Bolouri MS, Ray HN, Sihag S, Kamal M, Patterson N, Lander ES and Mann M. TITLE Integrated analysis of protein composition, tissue diversity, and gene regulation in mouse mitochondria JOURNAL Cell 115 (5), 629-640 (2003) PUBMED 14651853 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000160.1. On Dec 29, 2021 this sequence version replaced XM_006237805.4. ##Evidence-Data-START## Transcript exon combination :: FQ214529.1, FQ221067.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMD00132261, SAMD00132262 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## gene product(s) localized to mito. :: inferred from homology RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-173 JACYVU010000160.1 2738062-2738234 174-328 JACYVU010000160.1 2739543-2739697 329-494 JACYVU010000160.1 2740400-2740565 495-618 JACYVU010000160.1 2745245-2745368 619-1115 JACYVU010000160.1 2745984-2746480 FEATURES Location/Qualifiers source 1..1115 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="5" /map="5q12" gene 1..1115 /gene="Mrpl15" /note="mitochondrial ribosomal protein L15" /db_xref="GeneID:297799" /db_xref="RGD:1304796" exon 1..173 /gene="Mrpl15" /inference="alignment:Splign:2.1.0" CDS 69..956 /gene="Mrpl15" /EC_number="3.6.5.3" /note="isoform 1 is encoded by transcript variant 1; 39S ribosomal protein L15, mitochondrial" /codon_start=1 /product="39S ribosomal protein L15, mitochondrial isoform 1" /protein_id="NP_001385932.1" /db_xref="GeneID:297799" /db_xref="RGD:1304796" /translation="
MAGMAFGRGTSLDLLRSLPRVSLANLKPSLNSRKRERRPRDRRRGRKCGRGHKGERQRGTRPRLGFEGGQTPFYIRIPKYGFNEGHSFRHQYQPLSLRRLQYLIDLGRVDPTQPIDLTQLVNGRGVTIQPLKRDYGVQLVEEGADTFQAKVNIEVQMASELAIAAIEKNGGVVTTAFYDPRSLEILCKPVPFFLRGQPIPKRMLPPEALVPYYTDAKNRGYLADPAKFPEARLELAMKYGYVLPDVTKDELFRMLSTRKDPRQIFFGLAPGWIVNMADKKILKPTDENLLKYYSS"
misc_feature 222..590 /gene="Mrpl15" /note="Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A; Region: Ribosomal_L27A; pfam00828" /db_xref="CDD:425890" exon 174..328 /gene="Mrpl15" /inference="alignment:Splign:2.1.0" exon 329..494 /gene="Mrpl15" /inference="alignment:Splign:2.1.0" exon 495..618 /gene="Mrpl15" /inference="alignment:Splign:2.1.0" exon 619..1115 /gene="Mrpl15" /inference="alignment:Splign:2.1.0" ORIGIN
ggggcgtggccgtaaagcaatgcggagccttcgccgccttctgggcgcccttgaaaggaccgtgggccatggctggcatggcgtttggccgcgggaccagtctggaccttctgcggtccttgccgagagtgagcctggccaatctgaagcccagtcttaactccagaaaacgggaaagacgtccaagagatcggagaagaggtaggaagtgtggcagaggccataaaggagaaagacagagaggaacccggcccaggctgggctttgagggagggcagactccattttacatccgaatcccaaaatatggatttaatgaaggacatagtttcaggcaccagtatcagcctctgagtctcaggagactacagtatctcattgatttaggtcgagttgatccaactcaacctattgacttaacgcagcttgtgaatgggagaggtgtgaccatccagccacttaaaagggattatggggtccagctggttgaagagggtgctgatacttttcaagcaaaagttaatattgaggtgcagatggcttcagaattagccattgctgcaattgaaaaaaatggtggtgttgttactacagccttctatgacccaagaagtctagaaattctgtgcaagcctgttccattctttctgcgcggacaacccattccaaagagaatgcttccacccgaggcgctggtgccctattataccgatgcgaaaaaccgggggtacctggccgaccctgccaagtttcctgaagcaagactggaacttgccatgaagtatggctatgtccttcctgatgtcacgaaagacgaactcttcagaatgctcagcacccgcaaggatccaaggcagattttctttggtcttgctcctggctggatagtgaatatggcagataagaaaattctaaaacctacagatgagaatcttctcaagtattacagctcctgaactgccttcagtaaatcagacatgtgagccaggggggctgaacacgggctcgtgtgggccttaaagccgaggggctggtaccgcctgcactggtcaggtttcttgttctttttccatctgaaattaaataacaggcagcaaaagctgcatcggaactga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]