2024-05-18 19:06:32, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001004264 1490 bp mRNA linear ROD 22-MAR-2023 DEFINITION Rattus norvegicus kinetochore-localized astrin/SPAG5 binding protein (Knstrn), mRNA. ACCESSION NM_001004264 XM_230532 VERSION NM_001004264.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1490) AUTHORS Schmitz L, Grinblat B, Novak B, Hoeh AK, Handschke K, von Dobbeler C, Bierhoff E, Szeimies RM, Gambichler T, Torezan L, Festa-Neto C, Stockfleth E and Dirschka T. TITLE Somatic mutations in kinetochore gene KNSTRN are associated with basal proliferating actinic keratoses and cutaneous squamous cell carcinoma JOURNAL J Eur Acad Dermatol Venereol 33 (8), 1535-1540 (2019) PUBMED 30972880 REFERENCE 2 (bases 1 to 1490) AUTHORS Tochigi Y, Iwasaki Y, Sano M, Yasuda H, Katayama K and Suzuki H. TITLE Critical roles of Astrin in the mitosis of immature rat Sertoli cells JOURNAL Biochem Biophys Res Commun 486 (4), 958-964 (2017) PUBMED 28351621 REMARK GeneRIF: These results indicate that Astrin is required for normal mitotic progression in immature Sertoli cells and that the most severe type of testicullar dysplasia in hgn/hgn rats is caused by mitotic cell death of immature Sertoli cells due to lack of Astrin. REFERENCE 3 (bases 1 to 1490) AUTHORS Lee CS, Bhaduri A, Mah A, Johnson WL, Ungewickell A, Aros CJ, Nguyen CB, Rios EJ, Siprashvili Z, Straight A, Kim J, Aasi SZ and Khavari PA. TITLE Recurrent point mutations in the kinetochore gene KNSTRN in cutaneous squamous cell carcinoma JOURNAL Nat Genet 46 (10), 1060-1062 (2014) PUBMED 25194279 REFERENCE 4 (bases 1 to 1490) AUTHORS Dunsch AK, Linnane E, Barr FA and Gruneberg U. TITLE The astrin-kinastrin/SKAP complex localizes to microtubule plus ends and facilitates chromosome alignment JOURNAL J Cell Biol 192 (6), 959-968 (2011) PUBMED 21402792 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC079438.1. On Sep 10, 2004 this sequence version replaced XM_230532.2. ##Evidence-Data-START## Transcript exon combination :: BC079438.1, FQ226275.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMD00132261, SAMD00132262 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1490 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="3" /map="3q35" gene 1..1490 /gene="Knstrn" /gene_synonym="C15orf23; SKAP; Traf4af1" /note="kinetochore-localized astrin/SPAG5 binding protein" /db_xref="GeneID:311325" /db_xref="RGD:1303240" exon 1..278 /gene="Knstrn" /gene_synonym="C15orf23; SKAP; Traf4af1" /inference="alignment:Splign:2.1.0" CDS 70..1008 /gene="Knstrn" /gene_synonym="C15orf23; SKAP; Traf4af1" /note="putative TRAF4-associated factor 1; kinastrin; kinetochore-localized astrin-binding protein" /codon_start=1 /product="small kinetochore-associated protein" /protein_id="NP_001004264.1" /db_xref="GeneID:311325" /db_xref="RGD:1303240" /translation="
MATHKAEAQETDFRTTGPPTDLEQCPFPPSSRKFPFESVAADSTEGWAVAAEHHLKRSGEDGGWEQPASGVEPSRPTTMASSKTVCDAQPHSMPSCGLSADTQTRATSKLPVKSKDAEMLRHLHTGGLEPDVTKVTKPRRENGQGKAAETASRRNIRSSYKPLSKQKPEEDLKDKNELLEAVNKQLHQKLTETQGELKDLTQKVELLEKFQDNCLAILESKGLNSGQETQESKQEPSTDPTDSMLLLETLKDELKLFNETAKKQMEELQALKVKLKLKEKERIQFLEQQTLGKDEASDFTIILEEMEQLLEM"
misc_feature 70..165 /gene="Knstrn" /gene_synonym="C15orf23; SKAP; Traf4af1" /note="propagated from UniProtKB/Swiss-Prot (Q6AXN6.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 232..597 /gene="Knstrn" /gene_synonym="C15orf23; SKAP; Traf4af1" /note="propagated from UniProtKB/Swiss-Prot (Q6AXN6.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 535..1005 /gene="Knstrn" /gene_synonym="C15orf23; SKAP; Traf4af1" /note="propagated from UniProtKB/Swiss-Prot (Q6AXN6.1); Region: Interaction with SPAG5. /evidence=ECO:0000250|UniProtKB:Q9Y448" misc_feature 562..>870 /gene="Knstrn" /gene_synonym="C15orf23; SKAP; Traf4af1" /note="phosphodiesterase; Provisional; Region: PRK12704" /db_xref="CDD:237177" misc_feature 730..795 /gene="Knstrn" /gene_synonym="C15orf23; SKAP; Traf4af1" /note="propagated from UniProtKB/Swiss-Prot (Q6AXN6.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" exon 279..370 /gene="Knstrn" /gene_synonym="C15orf23; SKAP; Traf4af1" /inference="alignment:Splign:2.1.0" exon 371..497 /gene="Knstrn" /gene_synonym="C15orf23; SKAP; Traf4af1" /inference="alignment:Splign:2.1.0" exon 498..545 /gene="Knstrn" /gene_synonym="C15orf23; SKAP; Traf4af1" /inference="alignment:Splign:2.1.0" exon 546..651 /gene="Knstrn" /gene_synonym="C15orf23; SKAP; Traf4af1" /inference="alignment:Splign:2.1.0" exon 652..745 /gene="Knstrn" /gene_synonym="C15orf23; SKAP; Traf4af1" /inference="alignment:Splign:2.1.0" exon 746..801 /gene="Knstrn" /gene_synonym="C15orf23; SKAP; Traf4af1" /inference="alignment:Splign:2.1.0" exon 802..876 /gene="Knstrn" /gene_synonym="C15orf23; SKAP; Traf4af1" /inference="alignment:Splign:2.1.0" exon 877..1454 /gene="Knstrn" /gene_synonym="C15orf23; SKAP; Traf4af1" /inference="alignment:Splign:2.1.0" ORIGIN
gcccagtgcacccctagcccggccttgaccagcaggctggagcaacaccctacgaaccttccgtacagcatggcgactcacaaggccgaggcacaggagacagacttccgtacaacagggccgcccacagacttggaacagtgcccctttccgcccagctcccggaagtttccttttgaaagcgtggcggcagactctactgagggctgggcagttgctgcggagcatcatttgaaaaggagcggagaggacggcggatgggagcagccggcatcgggggtcgagccaagccgcccgactacgatggccagttctaagacggtgtgcgacgcgcagccccattcgatgccgagctgcggcttgtccgcagatacacaaactcgagctacttctaagctacctgttaaatccaaagacgctgagatgcttagacatcttcatacgggaggcttagagcctgacgttacaaaagtcaccaaaccaagacgagagaacgggcaggggaaagctgcggagactgccagccggaggaacatcagaagcagctacaaaccactgagtaagcaaaagccagaggaggatctgaaggataaaaacgagctgctggaggctgtcaacaagcagctacaccagaagctgacagagactcagggagagctgaaggacctgacacagaaggtggagctcctggagaagtttcaggataactgcttagcaattttggagagcaaaggtctcaactcaggccaagagacccaggaatcaaagcaggaacccagcacagatcccacggactccatgctgctgctagaaactttgaaagatgaactgaagcttttcaatgaaactgccaagaagcagatggaggagctacaggccttgaaggtgaagttgaagttgaaagaaaaagaaaggatccagttcctggaacagcaaaccttaggtaaggacgaagccagtgacttcacaataatcctggaggaaatggagcagctcttagaaatgtaatgcaaggcaagcgtccagacagcttcttcctgcataaactctcatcggaggccacttaggatatcttcaaggactcaccgtcccttaggtaaagaccttctgtagcagttgatccgataagggcagttgatgctgggggtcctcctttaagcagattgccccaccttcagatggctcagctctcctgcaagagaggaacctgggagtttgactccacttcctgcacaacagagagagcaacaaccttagaactaggatagtaaaccagccatggagactctcgagactcttacttggaaacacgggaggaaagcccacaccgagacagcacgtgcgctgtgcgggagctgtcacttcaagctatgctgtcccctttgtctggttgagctaagtttatgaacttgaaatccttgaagtcttttggcgtaataaattgggtggaggtaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]