GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-18 19:06:32, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001004264            1490 bp    mRNA    linear   ROD 22-MAR-2023
DEFINITION  Rattus norvegicus kinetochore-localized astrin/SPAG5 binding
            protein (Knstrn), mRNA.
ACCESSION   NM_001004264 XM_230532
VERSION     NM_001004264.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1490)
  AUTHORS   Schmitz L, Grinblat B, Novak B, Hoeh AK, Handschke K, von Dobbeler
            C, Bierhoff E, Szeimies RM, Gambichler T, Torezan L, Festa-Neto C,
            Stockfleth E and Dirschka T.
  TITLE     Somatic mutations in kinetochore gene KNSTRN are associated with
            basal proliferating actinic keratoses and cutaneous squamous cell
            carcinoma
  JOURNAL   J Eur Acad Dermatol Venereol 33 (8), 1535-1540 (2019)
   PUBMED   30972880
REFERENCE   2  (bases 1 to 1490)
  AUTHORS   Tochigi Y, Iwasaki Y, Sano M, Yasuda H, Katayama K and Suzuki H.
  TITLE     Critical roles of Astrin in the mitosis of immature rat Sertoli
            cells
  JOURNAL   Biochem Biophys Res Commun 486 (4), 958-964 (2017)
   PUBMED   28351621
  REMARK    GeneRIF: These results indicate that Astrin is required for normal
            mitotic progression in immature Sertoli cells and that the most
            severe type of testicullar dysplasia in hgn/hgn rats is caused by
            mitotic cell death of immature Sertoli cells due to lack of Astrin.
REFERENCE   3  (bases 1 to 1490)
  AUTHORS   Lee CS, Bhaduri A, Mah A, Johnson WL, Ungewickell A, Aros CJ,
            Nguyen CB, Rios EJ, Siprashvili Z, Straight A, Kim J, Aasi SZ and
            Khavari PA.
  TITLE     Recurrent point mutations in the kinetochore gene KNSTRN in
            cutaneous squamous cell carcinoma
  JOURNAL   Nat Genet 46 (10), 1060-1062 (2014)
   PUBMED   25194279
REFERENCE   4  (bases 1 to 1490)
  AUTHORS   Dunsch AK, Linnane E, Barr FA and Gruneberg U.
  TITLE     The astrin-kinastrin/SKAP complex localizes to microtubule plus
            ends and facilitates chromosome alignment
  JOURNAL   J Cell Biol 192 (6), 959-968 (2011)
   PUBMED   21402792
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC079438.1.
            
            On Sep 10, 2004 this sequence version replaced XM_230532.2.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC079438.1, FQ226275.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00132261, SAMD00132262
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1490
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="3"
                     /map="3q35"
     gene            1..1490
                     /gene="Knstrn"
                     /gene_synonym="C15orf23; SKAP; Traf4af1"
                     /note="kinetochore-localized astrin/SPAG5 binding protein"
                     /db_xref="GeneID:311325"
                     /db_xref="RGD:1303240"
     exon            1..278
                     /gene="Knstrn"
                     /gene_synonym="C15orf23; SKAP; Traf4af1"
                     /inference="alignment:Splign:2.1.0"
     CDS             70..1008
                     /gene="Knstrn"
                     /gene_synonym="C15orf23; SKAP; Traf4af1"
                     /note="putative TRAF4-associated factor 1; kinastrin;
                     kinetochore-localized astrin-binding protein"
                     /codon_start=1
                     /product="small kinetochore-associated protein"
                     /protein_id="NP_001004264.1"
                     /db_xref="GeneID:311325"
                     /db_xref="RGD:1303240"
                     /translation="
MATHKAEAQETDFRTTGPPTDLEQCPFPPSSRKFPFESVAADSTEGWAVAAEHHLKRSGEDGGWEQPASGVEPSRPTTMASSKTVCDAQPHSMPSCGLSADTQTRATSKLPVKSKDAEMLRHLHTGGLEPDVTKVTKPRRENGQGKAAETASRRNIRSSYKPLSKQKPEEDLKDKNELLEAVNKQLHQKLTETQGELKDLTQKVELLEKFQDNCLAILESKGLNSGQETQESKQEPSTDPTDSMLLLETLKDELKLFNETAKKQMEELQALKVKLKLKEKERIQFLEQQTLGKDEASDFTIILEEMEQLLEM"
     misc_feature    70..165
                     /gene="Knstrn"
                     /gene_synonym="C15orf23; SKAP; Traf4af1"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6AXN6.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    232..597
                     /gene="Knstrn"
                     /gene_synonym="C15orf23; SKAP; Traf4af1"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6AXN6.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    535..1005
                     /gene="Knstrn"
                     /gene_synonym="C15orf23; SKAP; Traf4af1"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6AXN6.1);
                     Region: Interaction with SPAG5.
                     /evidence=ECO:0000250|UniProtKB:Q9Y448"
     misc_feature    562..>870
                     /gene="Knstrn"
                     /gene_synonym="C15orf23; SKAP; Traf4af1"
                     /note="phosphodiesterase; Provisional; Region: PRK12704"
                     /db_xref="CDD:237177"
     misc_feature    730..795
                     /gene="Knstrn"
                     /gene_synonym="C15orf23; SKAP; Traf4af1"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6AXN6.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            279..370
                     /gene="Knstrn"
                     /gene_synonym="C15orf23; SKAP; Traf4af1"
                     /inference="alignment:Splign:2.1.0"
     exon            371..497
                     /gene="Knstrn"
                     /gene_synonym="C15orf23; SKAP; Traf4af1"
                     /inference="alignment:Splign:2.1.0"
     exon            498..545
                     /gene="Knstrn"
                     /gene_synonym="C15orf23; SKAP; Traf4af1"
                     /inference="alignment:Splign:2.1.0"
     exon            546..651
                     /gene="Knstrn"
                     /gene_synonym="C15orf23; SKAP; Traf4af1"
                     /inference="alignment:Splign:2.1.0"
     exon            652..745
                     /gene="Knstrn"
                     /gene_synonym="C15orf23; SKAP; Traf4af1"
                     /inference="alignment:Splign:2.1.0"
     exon            746..801
                     /gene="Knstrn"
                     /gene_synonym="C15orf23; SKAP; Traf4af1"
                     /inference="alignment:Splign:2.1.0"
     exon            802..876
                     /gene="Knstrn"
                     /gene_synonym="C15orf23; SKAP; Traf4af1"
                     /inference="alignment:Splign:2.1.0"
     exon            877..1454
                     /gene="Knstrn"
                     /gene_synonym="C15orf23; SKAP; Traf4af1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gcccagtgcacccctagcccggccttgaccagcaggctggagcaacaccctacgaaccttccgtacagcatggcgactcacaaggccgaggcacaggagacagacttccgtacaacagggccgcccacagacttggaacagtgcccctttccgcccagctcccggaagtttccttttgaaagcgtggcggcagactctactgagggctgggcagttgctgcggagcatcatttgaaaaggagcggagaggacggcggatgggagcagccggcatcgggggtcgagccaagccgcccgactacgatggccagttctaagacggtgtgcgacgcgcagccccattcgatgccgagctgcggcttgtccgcagatacacaaactcgagctacttctaagctacctgttaaatccaaagacgctgagatgcttagacatcttcatacgggaggcttagagcctgacgttacaaaagtcaccaaaccaagacgagagaacgggcaggggaaagctgcggagactgccagccggaggaacatcagaagcagctacaaaccactgagtaagcaaaagccagaggaggatctgaaggataaaaacgagctgctggaggctgtcaacaagcagctacaccagaagctgacagagactcagggagagctgaaggacctgacacagaaggtggagctcctggagaagtttcaggataactgcttagcaattttggagagcaaaggtctcaactcaggccaagagacccaggaatcaaagcaggaacccagcacagatcccacggactccatgctgctgctagaaactttgaaagatgaactgaagcttttcaatgaaactgccaagaagcagatggaggagctacaggccttgaaggtgaagttgaagttgaaagaaaaagaaaggatccagttcctggaacagcaaaccttaggtaaggacgaagccagtgacttcacaataatcctggaggaaatggagcagctcttagaaatgtaatgcaaggcaagcgtccagacagcttcttcctgcataaactctcatcggaggccacttaggatatcttcaaggactcaccgtcccttaggtaaagaccttctgtagcagttgatccgataagggcagttgatgctgggggtcctcctttaagcagattgccccaccttcagatggctcagctctcctgcaagagaggaacctgggagtttgactccacttcctgcacaacagagagagcaacaaccttagaactaggatagtaaaccagccatggagactctcgagactcttacttggaaacacgggaggaaagcccacaccgagacagcacgtgcgctgtgcgggagctgtcacttcaagctatgctgtcccctttgtctggttgagctaagtttatgaacttgaaatccttgaagtcttttggcgtaataaattgggtggaggtaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]