ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-10-05 19:51:13, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_063272151 797 bp mRNA linear ROD 22-FEB-2024
DEFINITION PREDICTED: Rattus norvegicus EF-hand calcium binding domain 2
(Efcab2), transcript variant X12, mRNA.
ACCESSION XM_063272151
VERSION XM_063272151.1
DBLINK BioProject: PRJNA1074393
KEYWORDS RefSeq.
SOURCE Rattus norvegicus (Norway rat)
ORGANISM Rattus norvegicus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NC_086031) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI RefSeq
Annotation Status :: Full annotation
Annotation Name :: GCF_036323735.1-RS_2024_02
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 10.2
Annotation Method :: Best-placed RefSeq; Gnomon;
cmsearch; tRNAscan-SE
Features Annotated :: Gene; mRNA; CDS; ncRNA
Annotation Date :: 02/09/2024
##Genome-Annotation-Data-END##
FEATURES Location/Qualifiers
source 1..797
/organism="Rattus norvegicus"
/mol_type="mRNA"
/strain="BN/NHsdMcwi"
/bio_material="RGD 61498"
/db_xref="taxon:10116"
/chromosome="13"
/sex="male"
/tissue_type="kidney, spleen, liver"
/geo_loc_name="USA: Wisconsin, Milwaukee"
/lat_lon="43.05 N 88.04 W"
/collected_by="Rebecca Schilling, Melinda Dwinell"
gene 1..797
/gene="Efcab2"
/gene_synonym="RGD1308593"
/note="EF-hand calcium binding domain 2; Derived by
automated computational analysis using gene prediction
method: Gnomon. Supporting evidence includes similarity
to: 2 long SRA reads"
/db_xref="GeneID:289280"
/db_xref="RGD:1308593"
CDS 58..600
/gene="Efcab2"
/gene_synonym="RGD1308593"
/codon_start=1
/product="dynein regulatory complex protein 8 isoform X9"
/protein_id="XP_063128221.1"
/db_xref="GeneID:289280"
/db_xref="RGD:1308593"
/translation="
MAASESQKLLVPSFTDSSEVFCSCLQTHQKRTSDPITDGCELPCSCWELNSGPLEEQSVLLTTEPSLQPEISNFISQPAECCNYREIGTIIRSLGCSPTEGELHDFIAEVEEEEPTGYIRFEKFIPVMTTVLLEKRYRPIAEDVLLRAFEVLDPTKRGFLTKDELVKYMTEEGQSIQVFP"
misc_feature <310..>579
/gene="Efcab2"
/gene_synonym="RGD1308593"
/note="calmodulin; Provisional; Region: PTZ00184"
/db_xref="CDD:185504"
polyA_site 797
/gene="Efcab2"
/gene_synonym="RGD1308593"
/experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN
agcccggagttgttctttcggggctgtgacctctagcagagactaagaagaaatggcatggcggcgagtgagagccagaaactccttgtcccctctttcacagactcttcagaagtattctgtagctgtcttcagactcaccagaagaggacatcagatcccattacagatggttgtgagctaccatgtagttgctgggaattgaactcaggacctctggaagagcagtctgttctcttaaccacggaaccatccctccagcccgaaataagtaattttatatctcagcctgctgagtgctgcaattatagagagattgggacgattatcaggtcgttaggatgcagccccactgaaggagaactgcacgatttcattgctgaggtagaggaagaagaacccactgggtacattcgatttgaaaaatttattccagtgatgaccacagtacttctagaaaaaagatacagaccaattgctgaagatgtccttttgcgagctttcgaggttttggatccaactaaacgtgggtttctgactaaggatgaactagtcaagtacatgactgaggaaggtcagtctatccaagtgtttccctgactgcgagcctttttcccaagaggaaatggaagaaatgttgtctgctgcaattgatcctgaatcaaacaccattaattacagagactacataacaatgatggtgatagatgaaaattaaatgctccaaagacttcttttttctccttttaagacaactgtaaacattcaatttctaattgaaaagatactttgaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]