LOCUS       XM_039093684            1123 bp    mRNA    linear   ROD 11-JUN-2023
DEFINITION  PREDICTED: Rattus norvegicus glia maturation factor, beta (Gmfb),
            transcript variant X3, mRNA.
ACCESSION   XM_039093684
VERSION     XM_039093684.1
DBLINK      BioProject: PRJNA677964
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_051350.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_015227675.2-RS_2023_06
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 06/06/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1123
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN/NHsdMcwi"
                     /db_xref="taxon:10116"
                     /chromosome="15"
                     /sex="male"
                     /tissue_type="kidney"
                     /country="USA: Wisconsin, Milwaukee, Medical College of
                     Wisconsin"
                     /collection_date="2019-03-08"
                     /collected_by="Rebecca Schilling"
     gene            1..1123
                     /gene="Gmfb"
                     /note="glia maturation factor, beta; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     ESTs, 2 long SRA reads, and 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 248
                     samples with support for all annotated introns"
                     /db_xref="GeneID:81661"
                     /db_xref="RGD:70910"
     CDS             789..1097
                     /gene="Gmfb"
                     /codon_start=1
                     /product="glia maturation factor beta isoform X3"
                     /protein_id="XP_038949612.1"
                     /db_xref="GeneID:81661"
                     /db_xref="RGD:70910"
                     /translation="

MSESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDKRLVVLDEELEGVSPDELKDELPERQPRPSLCIVINTSTTMAGSPTLCALSSPVLWGANLSSR"

     misc_feature    813..>989
                     /gene="Gmfb"
                     /note="Actin depolymerization factor/cofilin- and
                     gelsolin-like domains; Region: ADF_gelsolin; cl15697"
                     /db_xref="CDD:449582"
ORIGIN      

actaaaatttttttttatttcttatatttctttttcataaagttgccagccctttcatccacatcggcttttttgtaccccatactgtttcttaaaaagtcaagtttatctcagttttggaatgccagtagtaatacatttaaaaggtcgtaacttttgagtgtcgcactttgaaacagtaacagcacctgggcttcagagttcagtttggctgtgacttgagagtaagagcccgcatgatcacaactgatcaccatttattgagtatgaatactctttggaaaataaacgtatctagcaagttctgggaagcagacagggtcacggatggcgctctgggtcaggcggaaggatggaagcggcgtctacctttgaaaagccttaaatctggaagtaaactgtaaccaacacgcacatttaccgttaaaatcactgactcaggtttgtcaccacgacattgctgccgttcaggcttgtagaatatttaaagataccaagaatctgcgcactgcagcccggctcattcctgggtaaaccagcaggcagaacatccttagcagccacaagctgagcccgcgtccgcgtccgcgtccgcgtccgcgattcgcagaattttgggcctcgcctcccgccgtccgctgtcacgtgcgggccacggcggccgcgtagttaggtggggaacactgagctgtgtgccagccgaagcaggaagggaggtggctgcagagccattcttaaaggggcccaagagatcatacggcaacggacggctgacgaccggaaggaaaatgagtgagtctttggtggtttgtgatgttgctgaagatttagtggaaaagctgagaaagtttcgttttcgaaaagaaacccacaatgctgctattataatgaagattgacaaggataaacgcttggtggtgctggatgaggagctcgagggtgtctctccagatgaacttaaagatgaactacctgaacggcaacctcgaccttcattgtgtatagttataaataccagcacgacgatggccgggtctcctaccctctgtgctttatcttctccagtcctctggggtgcaaacctgagcagcagatgatgtacgctgggagtaagaacaagctg

//