LOCUS       XM_017592703             946 bp    mRNA    linear   ROD 11-JUN-2023
DEFINITION  PREDICTED: Rattus norvegicus microfibril associated protein 5
            (Mfap5), transcript variant X1, mRNA.
ACCESSION   XM_017592703
VERSION     XM_017592703.2
DBLINK      BioProject: PRJNA677964
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_051339.1) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Jan 21, 2021 this sequence version replaced XM_017592703.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_015227675.2-RS_2023_06
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 06/06/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..946
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN/NHsdMcwi"
                     /db_xref="taxon:10116"
                     /chromosome="4"
                     /sex="male"
                     /tissue_type="kidney"
                     /country="USA: Wisconsin, Milwaukee, Medical College of
                     Wisconsin"
                     /collection_date="2019-03-08"
                     /collected_by="Rebecca Schilling"
     gene            1..946
                     /gene="Mfap5"
                     /note="microfibril associated protein 5; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 mRNAs, 25 ESTs, 8 long SRA reads, 2 Proteins, and
                     100% coverage of the annotated genomic feature by RNAseq
                     alignments, including 87 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:362429"
                     /db_xref="RGD:1307919"
     CDS             249..749
                     /gene="Mfap5"
                     /codon_start=1
                     /product="microfibrillar-associated protein 5 isoform X1"
                     /protein_id="XP_017448192.1"
                     /db_xref="GeneID:362429"
                     /db_xref="RGD:1307919"
                     /translation="

MLVFGQKALLLVVALSIPSDWLPLGVSGQRGDDVPETFTDDPNLVNDPSTDDTVLADITPSTDDLASAGDKNTTAECRDEKFACTRLYSVHRPVRQCVHQACFTSLRRMYIINNEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENMNLQRPDGP"

     misc_feature    252..656
                     /gene="Mfap5"
                     /note="Microfibril-associated glycoprotein (MAGP); Region:
                     MAGP; pfam05507"
                     /db_xref="CDD:428500"
ORIGIN      

aacactgctttctacgcctctggcctggccccttctctctgtctctcttttctctctctccctccctccttccttgctcccccccaccccccattgtttcagagtaggccaaatgtgaagtctttccaagggtgtggctgtgttcatcttattctccagcccaagtggaacagaggaaaagccagagaaggacagacacactcggcagccagaggccacggcggacagagcacagcgctgtagacaatatgctggtctttgggcagaaggccttgctgcttgtcgtggcactcagcatcccctccgactggctacccctaggggtcagtggccaacgaggagatgacgtacccgagacattcacagatgaccctaatctggtgaatgatccttctacagacgatacagttctggcggatatcacaccttccacggatgacctggcctcagctggtgacaaaaatactactgcagagtgccgggatgagaagtttgcttgtacaagactgtactctgtccatcggcccgtcagacagtgtgtgcaccaggcctgcttcaccagtttacgtcgcatgtacatcatcaataatgagatctgttcccggcttgtctgtaaagaacacgaggccatgaaagatgagctttgccggcagatggcaggcctgcctccaaggcgactccgccgctccaactacttccgacttcctccctgtgaaaatatgaacttacagagacccgatggtccgtgatcaccaaggaagaacgaagaaagtgtggatgagggaatccgaaattccttctactccaaccgctgccatctgtcccgtagacgtgtatttttaaactaagccctttgcaatgtcccggcttcctaccctactctgtaattttcactggaactggtaacgtttgtctcgtttcgcaatacagtgtctccattgttgta

//