2024-04-26 01:10:40, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_198788 1292 bp mRNA linear ROD 22-NOV-2023 DEFINITION Rattus norvegicus succinate dehydrogenase complex subunit D (Sdhd), mRNA; nuclear gene for mitochondrial product. ACCESSION NM_198788 XM_343388 VERSION NM_198788.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1292) AUTHORS Fogarty MJ, Marin Mathieu N, Mantilla CB and Sieck GC. TITLE Aging reduces succinate dehydrogenase activity in rat type IIx/IIb diaphragm muscle fibers JOURNAL J Appl Physiol (1985) 128 (1), 70-77 (2020) PUBMED 31774353 REMARK GeneRIF: Aging reduces succinate dehydrogenase activity in rat type IIx/IIb diaphragm muscle fibers. REFERENCE 2 (bases 1 to 1292) AUTHORS Signes A and Fernandez-Vizarra E. TITLE Assembly of mammalian oxidative phosphorylation complexes I-V and supercomplexes JOURNAL Essays Biochem 62 (3), 255-270 (2018) PUBMED 30030361 REMARK Review article Publication Status: Online-Only REFERENCE 3 (bases 1 to 1292) AUTHORS Pfleger J, He M and Abdellatif M. TITLE Mitochondrial complex II is a source of the reserve respiratory capacity that is regulated by metabolic sensors and promotes cell survival JOURNAL Cell Death Dis 6 (7), e1835 (2015) PUBMED 26225774 REMARK GeneRIF: Metabolic sensors via Sirt3 maximize the cellular reserve respiratory capacity through activating mitochondrial complex II, which enhances cell survival after hypoxia. Publication Status: Online-Only REFERENCE 4 (bases 1 to 1292) AUTHORS Bardella C, Pollard PJ and Tomlinson I. TITLE SDH mutations in cancer JOURNAL Biochim Biophys Acta 1807 (11), 1432-1443 (2011) PUBMED 21771581 REMARK Review article REFERENCE 5 (bases 1 to 1292) AUTHORS Forner F, Kumar C, Luber CA, Fromme T, Klingenspor M and Mann M. TITLE Proteome differences between brown and white fat mitochondria reveal specialized metabolic functions JOURNAL Cell Metab 10 (4), 324-335 (2009) PUBMED 19808025 REFERENCE 6 (bases 1 to 1292) AUTHORS Mootha VK, Bunkenborg J, Olsen JV, Hjerrild M, Wisniewski JR, Stahl E, Bolouri MS, Ray HN, Sihag S, Kamal M, Patterson N, Lander ES and Mann M. TITLE Integrated analysis of protein composition, tissue diversity, and gene regulation in mouse mitochondria JOURNAL Cell 115 (5), 629-640 (2003) PUBMED 14651853 REFERENCE 7 (bases 1 to 1292) AUTHORS Naito Y, Tsujino T, Kawasaki D, Okumura T, Morimoto S, Masai M, Sakoda T, Fujioka Y, Ohyanagi M and Iwasaki T. TITLE Circadian gene expression of clock genes and plasminogen activator inhibitor-1 in heart and aorta of spontaneously hypertensive and Wistar-Kyoto rats JOURNAL J Hypertens 21 (6), 1107-1115 (2003) PUBMED 12777947 REFERENCE 8 (bases 1 to 1292) AUTHORS Kietzmann T, Jungermann K and Gorlach A. TITLE Regulation of the hypoxia-dependent plasminogen activator inhibitor 1 expression by MAP kinases JOURNAL Thromb Haemost 89 (4), 666-673 (2003) PUBMED 12669121 REFERENCE 9 (bases 1 to 1292) AUTHORS Baysal BE, Ferrell RE, Willett-Brozick JE, Lawrence EC, Myssiorek D, Bosch A, van der Mey A, Taschner PE, Rubinstein WS, Myers EN, Richard CW 3rd, Cornelisse CJ, Devilee P and Devlin B. TITLE Mutations in SDHD, a mitochondrial complex II gene, in hereditary paraganglioma JOURNAL Science 287 (5454), 848-851 (2000) PUBMED 10657297 REFERENCE 10 (bases 1 to 1292) AUTHORS Hirawake H, Taniwaki M, Tamura A, Kojima S and Kita K. TITLE Cytochrome b in human complex II (succinate-ubiquinone oxidoreductase): cDNA cloning of the components in liver mitochondria and chromosome assignment of the genes for the large (SDHC) and small (SDHD) subunits to 1q21 and 11q23 JOURNAL Cytogenet Cell Genet 79 (1-2), 132-138 (1997) PUBMED 9533030 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000198.1. On Mar 19, 2021 this sequence version replaced NM_198788.2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: FQ230166.1, FQ215355.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5756307, SAMEA5760383 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## gene product(s) localized to mito. :: inferred from homology RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-111 JACYVU010000198.1 12767455-12767565 c 112-228 JACYVU010000198.1 12765125-12765241 c 229-373 JACYVU010000198.1 12763349-12763493 c 374-1292 JACYVU010000198.1 12758013-12758931 c FEATURES Location/Qualifiers source 1..1292 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="8" /map="8q23" gene 1..1292 /gene="Sdhd" /gene_synonym="CII-4; cybS; QPs3" /note="succinate dehydrogenase complex subunit D" /db_xref="GeneID:363061" /db_xref="RGD:735231" exon 1..111 /gene="Sdhd" /gene_synonym="CII-4; cybS; QPs3" /inference="alignment:Splign:2.1.0" misc_feature 42..44 /gene="Sdhd" /gene_synonym="CII-4; cybS; QPs3" /note="upstream in-frame stop codon" CDS 60..539 /gene="Sdhd" /gene_synonym="CII-4; cybS; QPs3" /note="succinate-ubiquinone reductase membrane anchor subunit; succinate-ubiquinone oxidoreductase cytochrome b small subunit; succinate dehydrogenase complex, subunit D, integral membrane protein" /codon_start=1 /product="succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial" /protein_id="NP_942083.1" /db_xref="GeneID:363061" /db_xref="RGD:735231" /translation="
MAVLLKLGVLCSGQGARALSLRSRAVRPAFVSAFLQDQPTPGWRGTQHIHLSPSHQSGSKAASLHWTSERVVSVLLLGLIPAGYLNPCSVVDYSLAAALTLHSHWGIGQVVTDYVHGDALQKATKAGLLAVSALTFAGLCYFNYHDVGICRAVAMLWKL"
transit_peptide 60..227 /gene="Sdhd" /gene_synonym="CII-4; cybS; QPs3" /note="Mitochondrion. /evidence=ECO:0000255; propagated from UniProtKB/Swiss-Prot (Q6PCT8.1)" mat_peptide 228..536 /gene="Sdhd" /gene_synonym="CII-4; cybS; QPs3" /product="Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial. /id=PRO_0000006489" /note="propagated from UniProtKB/Swiss-Prot (Q6PCT8.1)" misc_feature 237..533 /gene="Sdhd" /gene_synonym="CII-4; cybS; QPs3" /note="SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. Eukaryotic SQRs reduce high potential quinones such as ubiquinone. SQR is also called succinate dehydrogenase or Complex II, and is part of the citric...; Region: SQR_TypeC_CybS; cd03496" /db_xref="CDD:239576" misc_feature order(237..239,243..248,384..386,393..398,405..407) /gene="Sdhd" /gene_synonym="CII-4; cybS; QPs3" /note="Iron-sulfur protein interface [active]" /db_xref="CDD:239576" misc_feature 249..314 /gene="Sdhd" /gene_synonym="CII-4; cybS; QPs3" /note="propagated from UniProtKB/Swiss-Prot (Q6PCT8.1); transmembrane region" misc_feature order(267..269,396..401,462..464,471..473,480..482, 495..497,513..515,528..530) /gene="Sdhd" /gene_synonym="CII-4; cybS; QPs3" /note="CybL subunit interface [polypeptide binding]; other site" /db_xref="CDD:239576" misc_feature order(306..311,519..521,528..530) /gene="Sdhd" /gene_synonym="CII-4; cybS; QPs3" /note="distal quinone binding site [chemical binding]; other site" /db_xref="CDD:239576" misc_feature 330..392 /gene="Sdhd" /gene_synonym="CII-4; cybS; QPs3" /note="propagated from UniProtKB/Swiss-Prot (Q6PCT8.1); transmembrane region" misc_feature order(363..365,375..377) /gene="Sdhd" /gene_synonym="CII-4; cybS; QPs3" /note="proximal heme binding site [chemical binding]; other site" /db_xref="CDD:239576" misc_feature 399..401 /gene="Sdhd" /gene_synonym="CII-4; cybS; QPs3" /note="proximal quinone binding site [chemical binding]; other site" /db_xref="CDD:239576" misc_feature 420..485 /gene="Sdhd" /gene_synonym="CII-4; cybS; QPs3" /note="propagated from UniProtKB/Swiss-Prot (Q6PCT8.1); transmembrane region" exon 112..228 /gene="Sdhd" /gene_synonym="CII-4; cybS; QPs3" /inference="alignment:Splign:2.1.0" exon 229..373 /gene="Sdhd" /gene_synonym="CII-4; cybS; QPs3" /inference="alignment:Splign:2.1.0" exon 374..1292 /gene="Sdhd" /gene_synonym="CII-4; cybS; QPs3" /inference="alignment:Splign:2.1.0" ORIGIN
gggacttacgacataactgcttccgggccgtagggtgaccttgagccctcaaaagcgaaatggcggttctcttaaagctgggcgttctctgcagtggccaaggagctcgagctctgtcactccgaagccgggcggtcagacctgcttttgtgtccgcatttctccaggaccagcctaccccaggatggcgtggcacccagcacatccacctgtcaccaagccaccagtctggttccaaggccgcatctctccactggaccagtgagagggttgtcagtgttttgctcttgggcctgattccagctgggtacttgaatccctgctctgtggtggactactctctggctgcagccctcaccctgcacagtcactggggcattggacaagtggttactgactacgttcatggggacgcactgcagaaggctaccaaggcaggcctcttggcagtctcagctttgacctttgctgggctttgctacttcaattaccacgatgtaggcatctgcagagcggttgccatgctgtggaagctctgacctcttggtgtagcactttgattgtatgcctccttgcctctgctttatcaatgctgttcacctcacaatgaggagggatgaagaataaatccgttggtgggcagaatgtcttgtaattacatggctattttcagaatttatttgttgaggaattaggttcactcattcgtgagtctgagttccattgtcactgagtctggtcgccagctcatgtgactcatggtgtaactgaacatttcataagctcatgttgcctttgatcactgtttcttaaggagagccagctaattgctgtcaggataagagtagacttctctcctcagactgggagggaggactgttcattcgtgagtcagagtttgcatgaaattgaacagtattctgtttggaaccttccactcttgttcaggtggccccagctgttggtggctctgtttctaggggacttttaatcaggagatgccctcaattactgatgtttttaagtcttaggaaggaaattgaggaaagttagatttcgggaagttcaatttagggagctctcctttgtagaagggttcaaatatgacagatcgcaaacagacttactcttcaaatgtctctcacttgtgcaggaatgagctgtccaaaaaaagtaagactaagtaataaactgtcttcccaccgtgggagttgtcaatgagaaagtgtactctggaaaagcaaaatttttaaataaaatattatataatgattatacattgcactctttaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]