LOCUS       NM_053819                740 bp    mRNA    linear   ROD 30-JUL-2024
DEFINITION  Rattus norvegicus TIMP metallopeptidase inhibitor 1 (Timp1), mRNA.
ACCESSION   NM_053819
VERSION     NM_053819.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 740)
  AUTHORS   Xi,X., Yang,Y., Chen,Q., Ma,J., Wang,X., Deng,Y., Wang,X. and Li,Y.
  TITLE     GnT-V-mediated aberrant N-glycosylation of TIMP-1 promotes diabetic
            retinopathy progression
  JOURNAL   Mol Biol Rep 51 (1), 428 (2024)
   PUBMED   38499842
  REMARK    GeneRIF: GnT-V-mediated aberrant N-glycosylation of TIMP-1 promotes
            diabetic retinopathy progression.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 740)
  AUTHORS   Ahmadighadykolaei,H., Lambert,J.A. and Raeeszadeh-Sarmazdeh,M.
  TITLE     TIMP-1 Protects Tight Junctions of Brain Endothelial Cells From
            MMP-Mediated Degradation
  JOURNAL   Pharm Res 40 (9), 2121-2131 (2023)
   PUBMED   37700105
  REMARK    GeneRIF: TIMP-1 Protects Tight Junctions of Brain Endothelial Cells
            From MMP-Mediated Degradation.
REFERENCE   3  (bases 1 to 740)
  AUTHORS   Huang,S., Chen,M., Yu,H., Lin,K., Guo,Y. and Zhu,P.
  TITLE     Co-expression of tissue kallikrein 1 and tissue inhibitor of matrix
            metalloproteinase 1 improves myocardial ischemia-reperfusion injury
            by promoting angiogenesis and inhibiting oxidative stress
  JOURNAL   Mol Med Rep 23 (2) (2021)
   PUBMED   33355364
  REMARK    GeneRIF: Coexpression of tissue kallikrein 1 and tissue inhibitor
            of matrix metalloproteinase 1 improves myocardial
            ischemiareperfusion injury by promoting angiogenesis and inhibiting
            oxidative stress.
REFERENCE   4  (bases 1 to 740)
  AUTHORS   Yuan,Y., Naito,H., Kitamori,K., Hashimoto,S., Asano,T. and
            Nakajima,T.
  TITLE     The antihypertensive agent hydralazine reduced extracellular matrix
            synthesis and liver fibrosis in nonalcoholic steatohepatitis
            exacerbated by hypertension
  JOURNAL   PLoS One 15 (12), e0243846 (2020)
   PUBMED   33315911
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 740)
  AUTHORS   Samper Agrelo,I., Schira-Heinen,J., Beyer,F., Groh,J.,
            Butermann,C., Estrada,V., Poschmann,G., Bribian,A., Jadasz,J.J.,
            Lopez-Mascaraque,L., Kremer,D., Martini,R., Muller,H.W.,
            Hartung,H.P., Adjaye,J., Stuhler,K. and Kury,P.
  TITLE     Secretome Analysis of Mesenchymal Stem Cell Factors Fostering
            Oligodendroglial Differentiation of Neural Stem Cells In Vivo
  JOURNAL   Int J Mol Sci 21 (12), 4350 (2020)
   PUBMED   32570968
  REMARK    GeneRIF: Secretome Analysis of Mesenchymal Stem Cell Factors
            Fostering Oligodendroglial Differentiation of Neural Stem Cells In
            Vivo.
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 740)
  AUTHORS   Boujrad,N., Ogwuegbu,S.O., Garnier,M., Lee,C.H., Martin,B.M. and
            Papadopoulos,V.
  TITLE     Identification of a stimulator of steroid hormone synthesis
            isolated from testis
  JOURNAL   Science 268 (5217), 1609-1612 (1995)
   PUBMED   7777858
  REMARK    Erratum:[Science 1995 Oct 20;270(5235):365]
REFERENCE   7  (bases 1 to 740)
  AUTHORS   Chun,S.Y., Popliker,M., Reich,R. and Tsafriri,A.
  TITLE     Localization of preovulatory expression of plasminogen activator
            inhibitor type-1 and tissue inhibitor of metalloproteinase type-1
            mRNAs in the rat ovary
  JOURNAL   Biol Reprod 47 (2), 245-253 (1992)
   PUBMED   1327205
REFERENCE   8  (bases 1 to 740)
  AUTHORS   Roswit,W.T., McCourt,D.W., Partridge,N.C. and Jeffrey,J.J.
  TITLE     Purification and sequence analysis of two rat tissue inhibitors of
            metalloproteinases
  JOURNAL   Arch Biochem Biophys 292 (2), 402-410 (1992)
   PUBMED   1309971
REFERENCE   9  (bases 1 to 740)
  AUTHORS   Docherty,A.J., Lyons,A., Smith,B.J., Wright,E.M., Stephens,P.E.,
            Harris,T.J., Murphy,G. and Reynolds,J.J.
  TITLE     Sequence of human tissue inhibitor of metalloproteinases and its
            identity to erythroid-potentiating activity
  JOURNAL   Nature 318 (6041), 66-69 (1985)
   PUBMED   3903517
REFERENCE   10 (bases 1 to 740)
  AUTHORS   Gasson,J.C., Golde,D.W., Kaufman,S.E., Westbrook,C.A., Hewick,R.M.,
            Kaufman,R.J., Wong,G.G., Temple,P.A., Leary,A.C., Brown,E.L. et al.
  TITLE     Molecular characterization and expression of the gene encoding
            human erythroid-potentiating activity
  JOURNAL   Nature 315 (6022), 768-771 (1985)
   PUBMED   3839290
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from L31883.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: L31883.1, FQ219856.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN16093045, SAMN16093046
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..740
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="X"
                     /map="Xq11"
     gene            1..740
                     /gene="Timp1"
                     /gene_synonym="Timp; TIMP-1"
                     /note="TIMP metallopeptidase inhibitor 1"
                     /db_xref="GeneID:116510"
                     /db_xref="RGD:621675"
     exon            1..24
                     /gene="Timp1"
                     /gene_synonym="Timp; TIMP-1"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    9..11
                     /gene="Timp1"
                     /gene_synonym="Timp; TIMP-1"
                     /note="upstream in-frame stop codon"
     exon            25..156
                     /gene="Timp1"
                     /gene_synonym="Timp; TIMP-1"
                     /inference="alignment:Splign:2.1.0"
     CDS             36..689
                     /gene="Timp1"
                     /gene_synonym="Timp; TIMP-1"
                     /function="tissue inhibitor of metalloproteinase (type 1)"
                     /note="metalloproteinase inhibitor 1; tissue inhibitor of
                     metalloproteinases 1; tissue inhibitor of
                     metalloproteinase 1; tissue inhibitor of metallopeptidase
                     1"
                     /codon_start=1
                     /product="metalloproteinase inhibitor 1 precursor"
                     /protein_id="NP_446271.1"
                     /db_xref="GeneID:116510"
                     /db_xref="RGD:621675"
                     /translation="

MAPFASLASGILLLLSLIASSKACSCAPTHPQTAFCNSDLVIRAKFMGSPEIIETTLYQRYEIKMTKMLKGFDAVGNATGFRFAYTPAMESLCGYVHKSQNRSEEFLIAGRLRNGNLHITACSFLVPWHNLSPAQQKAFVKTYSAGCGVCTVFPCSAIPCKLESDSHCLWTDQILMGSEKGYQSDHFACLPRNPDLCTWQYLGVSMTRSLPLAKAEA"

     sig_peptide     36..104
                     /gene="Timp1"
                     /gene_synonym="Timp; TIMP-1"
                     /inference="COORDINATES: ab initio prediction:SignalP:6.0"
     mat_peptide     105..686
                     /gene="Timp1"
                     /gene_synonym="Timp; TIMP-1"
                     /product="metalloproteinase inhibitor 1"
                     /function="tissue inhibitor of metalloproteinase (type 1)"
     misc_feature    105..632
                     /gene="Timp1"
                     /gene_synonym="Timp; TIMP-1"
                     /note="Tissue inhibitor of metalloproteinase family;
                     Region: NTR; smart00206"
                     /db_xref="CDD:128502"
     misc_feature    105..116
                     /gene="Timp1"
                     /gene_synonym="Timp; TIMP-1"
                     /note="propagated from UniProtKB/Swiss-Prot (P30120.2);
                     Region: Involved in metalloproteinase-binding.
                     /evidence=ECO:0000250|UniProtKB:P16035"
     misc_feature    144..146
                     /gene="Timp1"
                     /gene_synonym="Timp; TIMP-1"
                     /note="Involved in metalloproteinase-binding.
                     /evidence=ECO:0000250|UniProtKB:P16035; propagated from
                     UniProtKB/Swiss-Prot (P30120.2); other site"
     misc_feature    264..266
                     /gene="Timp1"
                     /gene_synonym="Timp; TIMP-1"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (P30120.2); glycosylation site"
     misc_feature    303..308
                     /gene="Timp1"
                     /gene_synonym="Timp; TIMP-1"
                     /note="propagated from UniProtKB/Swiss-Prot (P30120.2);
                     Region: Involved in metalloproteinase-binding.
                     /evidence=ECO:0000250|UniProtKB:P16035"
     misc_feature    336..338
                     /gene="Timp1"
                     /gene_synonym="Timp; TIMP-1"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (P30120.2); glycosylation site"
     misc_feature    567..569
                     /gene="Timp1"
                     /gene_synonym="Timp; TIMP-1"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P01033; propagated from
                     UniProtKB/Swiss-Prot (P30120.2); phosphorylation site"
     exon            157..236
                     /gene="Timp1"
                     /gene_synonym="Timp; TIMP-1"
                     /inference="alignment:Splign:2.1.0"
     exon            237..363
                     /gene="Timp1"
                     /gene_synonym="Timp; TIMP-1"
                     /inference="alignment:Splign:2.1.0"
     exon            364..488
                     /gene="Timp1"
                     /gene_synonym="Timp; TIMP-1"
                     /inference="alignment:Splign:2.1.0"
     exon            489..740
                     /gene="Timp1"
                     /gene_synonym="Timp; TIMP-1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

cggactcctagagacacgctagagcagataccacgatggcgccctttgcatctctggcctctggcatcctcttgttgctatcattgatagcttccagtaaagcctgtagctgtgccccaacccacccacagacagctttctgcaactcggacctggttataagggctaaattcatgggttccccagaaatcatcgagaccaccttataccagcgttatgagatcaagatgactaagatgctcaaaggattcgacgctgtgggaaatgccacaggtttccggttcgcctacaccccagccatggagagcctctgtggatatgtccacaagtcccagaaccgcagcgaggagtttctcatcgcgggccgtttaaggaacggaaatttgcacatcactgcctgcagcttcctggttccctggcataatctgagccctgctcagcaaaaggccttcgtaaagacctatagtgctggctgtggggtgtgcacagtgtttccctgttcagccatcccttgcaaactggagagtgacagtcattgcttgtggacagatcagatcctcatgggctctgagaagggctaccagagcgatcactttgcctgcctgccacggaatccagatttgtgcacctggcaataccttggggtctcgatgacccgaagccttcccctggcaaaagctgaagcctgaacactgtttacctttcctccatctttctttctcttaaatggtgaaataaag

//