2024-04-19 20:09:14, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_053602 571 bp mRNA linear ROD 07-MAY-2023 DEFINITION Rattus norvegicus ATP synthase peripheral stalk subunit F6 (Atp5pf), mRNA; nuclear gene for mitochondrial product. ACCESSION NM_053602 VERSION NM_053602.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 571) AUTHORS Zhu C, Zhang W, Liu J, Mu B, Zhang F, Lai N, Zhou J, Xu A and Li Y. TITLE Marine collagen peptides reduce endothelial cell injury in diabetic rats by inhibiting apoptosis and the expression of coupling factor 6 and microparticles JOURNAL Mol Med Rep 16 (4), 3947-3957 (2017) PUBMED 28731155 REFERENCE 2 (bases 1 to 571) AUTHORS Li N, Yin J, Cai W, Liu J, Zhang N, Yan S, Song L and Li X. TITLE Coupling Factor 6 Is Upregulated in Monocrotaline-induced Pulmonary Arterial Hypertension in Rats JOURNAL Am J Med Sci 352 (6), 631-636 (2016) PUBMED 27916219 REMARK GeneRIF: plasma level increased markedly during pathogenesis of pulmonary arterial hypertension (PAH), indicating that CF6 may be involved in the development of PAH REFERENCE 3 (bases 1 to 571) AUTHORS Yin J, You S, Li N, Jiao S, Hu H, Xue M, Wang Y, Cheng W, Liu J, Xu M, Yan S and Li X. TITLE Lung-specific RNA interference of coupling factor 6, a novel peptide, attenuates pulmonary arterial hypertension in rats JOURNAL Respir Res 17 (1), 99 (2016) PUBMED 27491388 REMARK GeneRIF: CF6 shRNA effectively inhibited CF6 expression, abolished lung macrophage infiltration, reversed endothelial dysfunction and vascular remodeling, and ameliorated the severity of pulmonary hypertension and right ventricular dysfunction at 4 weeks both as a pretreatment and rescue intervention Publication Status: Online-Only REFERENCE 4 (bases 1 to 571) AUTHORS He T, Guan A, Shi Y, Ge Z and Dai H. TITLE Mitochondrial coupling factor 6 upregulation in hypertension-induced cardiac hypertrophy JOURNAL Herz 40 (5), 783-787 (2015) PUBMED 25900768 REMARK GeneRIF: CF6 protein was upregulated in cardiac hypertrophy induced by hypertension; further mechanisms involved in this process should be investigated. REFERENCE 5 (bases 1 to 571) AUTHORS Ramm S, Morissey B, Hernandez B, Rooney C, Pennington SR and Mally A. TITLE Application of a discovery to targeted LC-MS proteomics approach to identify deregulated proteins associated with idiosyncratic liver toxicity in a rat model of LPS/diclofenac co-administration JOURNAL Toxicology 331, 100-111 (2015) PUBMED 25772430 REFERENCE 6 (bases 1 to 571) AUTHORS Osanai T, Kamada T, Fujiwara N, Katoh T, Takahashi K, Kimura M, Satoh K, Magota K, Kodama S, Tanaka T and Okumura K. TITLE A novel inhibitory effect on prostacyclin synthesis of coupling factor 6 extracted from the heart of spontaneously hypertensive rats JOURNAL J Biol Chem 273 (48), 31778-31783 (1998) PUBMED 9822642 REFERENCE 7 (bases 1 to 571) AUTHORS Higuti T, Yoshihara Y, Kuroiwa K, Kawamura Y, Toda H and Sakiyama F. TITLE A simple, rapid method for purification of epsilon-subunit, coupling factor 6, subunit d, and subunit e from rat liver H(+)-ATP synthase and determination of the complete amino acid sequence of epsilon-subunit JOURNAL J Biol Chem 267 (31), 22658-22661 (1992) PUBMED 1429613 REFERENCE 8 (bases 1 to 571) AUTHORS Tracer HL, Loh YP and Birch NP. TITLE Rat mitochondrial coupling factor 6: molecular cloning of a cDNA encoding the imported precursor JOURNAL Gene 116 (2), 291-292 (1992) PUBMED 1386054 REFERENCE 9 (bases 1 to 571) AUTHORS Yoshihara Y, Nagase H, Yamane T, Oka H, Tani I and Higuti T. TITLE H(+)-ATP synthase from rat liver mitochondria. A simple, rapid purification method of the functional complex and its characterization JOURNAL Biochemistry 30 (28), 6854-6860 (1991) PUBMED 1829963 REFERENCE 10 (bases 1 to 571) AUTHORS Higuti T, Osaka F, Yoshihara Y, Tsurumi C, Kawamura Y, Tani I, Toda H, Kakuno T, Sakiyama F, Tanaka K et al. TITLE cDNA cloning and sequencing for the import precursor of coupling factor 6 in H(+)-ATP synthase from rat liver mitochondria JOURNAL Biochem Biophys Res Commun 171 (3), 1079-1086 (1990) PUBMED 2145831 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from X54510.1. On Feb 21, 2013 this sequence version replaced NM_053602.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: X54510.1, BG666039.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5756307, SAMEA5760383 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## gene product(s) localized to mito. :: inferred from homology RefSeq Select criteria :: based on conservation, expression ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-571 X54510.1 1-571 FEATURES Location/Qualifiers source 1..571 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="11" /map="11q11" gene 1..571 /gene="Atp5pf" /gene_synonym="Atp5j" /note="ATP synthase peripheral stalk subunit F6" /db_xref="GeneID:94271" /db_xref="RGD:621376" exon 1..145 /gene="Atp5pf" /gene_synonym="Atp5j" /inference="alignment:Splign:2.1.0" misc_feature 96..98 /gene="Atp5pf" /gene_synonym="Atp5j" /note="upstream in-frame stop codon" exon 146..325 /gene="Atp5pf" /gene_synonym="Atp5j" /inference="alignment:Splign:2.1.0" CDS 162..488 /gene="Atp5pf" /gene_synonym="Atp5j" /EC_number="3.6.1.14" /note="ATP synthase-coupling factor 6, mitochondrial; ATPase subunit F6; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F6" /codon_start=1 /product="ATP synthase-coupling factor 6, mitochondrial precursor" /protein_id="NP_446054.1" /db_xref="GeneID:94271" /db_xref="RGD:621376" /translation="
MTVQRIFRLSSVLRSAVSVHLRRNIGVTAVAFNKELDPVQKLFLDKIREYKAKRLASGGPVDTGPEYQQEVDRELFKLKQMYGKGEMDKFPTFNFEDPKFEVLDKPQS"
misc_feature 162..449 /gene="Atp5pf" /gene_synonym="Atp5j" /note="Mitochondrial ATP synthase coupling factor 6; Region: ATP-synt_F6; pfam05511" /db_xref="CDD:428503" transit_peptide 162..257 /gene="Atp5pf" /gene_synonym="Atp5j" /note="Mitochondrion. /evidence=ECO:0000269|PubMed:1429613; propagated from UniProtKB/Swiss-Prot (P21571.1)" mat_peptide 258..485 /gene="Atp5pf" /gene_synonym="Atp5j" /product="ATP synthase-coupling factor 6, mitochondrial" misc_feature 282..284 /gene="Atp5pf" /gene_synonym="Atp5j" /note="N6-acetyllysine. /evidence=ECO:0000250|UniProtKB:P18859; propagated from UniProtKB/Swiss-Prot (P21571.1); acetylation site" misc_feature 297..299 /gene="Atp5pf" /gene_synonym="Atp5j" /note="N6-acetyllysine. /evidence=ECO:0000250|UniProtKB:P18859; propagated from UniProtKB/Swiss-Prot (P21571.1); acetylation site" misc_feature 396..398 /gene="Atp5pf" /gene_synonym="Atp5j" /note="N6-acetyllysine. /evidence=ECO:0000250|UniProtKB:P97450; propagated from UniProtKB/Swiss-Prot (P21571.1); acetylation site" misc_feature 411..413 /gene="Atp5pf" /gene_synonym="Atp5j" /note="N6-acetyllysine, alternate. /evidence=ECO:0000250|UniProtKB:P97450; propagated from UniProtKB/Swiss-Prot (P21571.1); acetylation site" misc_feature 456..458 /gene="Atp5pf" /gene_synonym="Atp5j" /note="N6-acetyllysine, alternate. /evidence=ECO:0000250|UniProtKB:P18859; propagated from UniProtKB/Swiss-Prot (P21571.1); acetylation site" misc_feature 474..476 /gene="Atp5pf" /gene_synonym="Atp5j" /note="N6-acetyllysine. /evidence=ECO:0000250|UniProtKB:P18859; propagated from UniProtKB/Swiss-Prot (P21571.1); acetylation site" misc_feature 483..485 /gene="Atp5pf" /gene_synonym="Atp5j" /note="Phosphoserine. /evidence=ECO:0007744|PubMed:22673903; propagated from UniProtKB/Swiss-Prot (P21571.1); phosphorylation site" exon 326..450 /gene="Atp5pf" /gene_synonym="Atp5j" /inference="alignment:Splign:2.1.0" exon 451..571 /gene="Atp5pf" /gene_synonym="Atp5j" /inference="alignment:Splign:2.1.0" ORIGIN
gcttcctgtccggtgagcgtcgaacgactgaagcggtggcccatagtgcattgcgatggcgggtaggcgtgtgtaggcggagccagggccggaagtagaacggtggcggcggcggtgactctggcagctcgggactcagtgcaagtaccacagactcaaccatgactgttcagaggatcttcaggctctcctctgtccttcggtcagcagtctctgtgcatttgaggaggaacattggtgttacagctgtggcgtttaataaggaacttgatcctgtacagaaactcttcttggacaagataagagagtacaaagcaaagcgactggcgtctggaggacctgttgatactggcccagaatatcagcaagaggtggacagagagctttttaagcttaaacaaatgtatggtaaaggagagatggataagtttcctaccttcaattttgaggatcccaaatttgaagtcctcgacaaaccccagtcctgaggaacatacaaaccatgtggtaatttgtcatgacttagttgtacaattaatctaaaaaattcaaataaacattcacttcacag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]