2024-03-29 21:35:52, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_053324 1506 bp mRNA linear ROD 22-MAR-2023 DEFINITION Rattus norvegicus synaptotagmin 9 (Syt9), mRNA. ACCESSION NM_053324 VERSION NM_053324.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1506) AUTHORS Gautam V, D'Avanzo C, Berezovska O, Tanzi RE and Kovacs DM. TITLE Synaptotagmins interact with APP and promote Abeta generation JOURNAL Mol Neurodegener 10, 31 (2015) PUBMED 26202512 REMARK GeneRIF: Syt-9 regulates endogenous APP-CTF and Abeta levels in PC12 cells. Publication Status: Online-Only REFERENCE 2 (bases 1 to 1506) AUTHORS Zhang Z, Wu Y, Wang Z, Dunning FM, Rehfuss J, Ramanan D, Chapman ER and Jackson MB. TITLE Release mode of large and small dense-core vesicles specified by different synaptotagmin isoforms in PC12 cells JOURNAL Mol Biol Cell 22 (13), 2324-2336 (2011) PUBMED 21551071 REFERENCE 3 (bases 1 to 1506) AUTHORS Matsuoka H, Harada K, Nakamura J, Fukuda M and Inoue M. TITLE Differential distribution of synaptotagmin-1, -4, -7, and -9 in rat adrenal chromaffin cells JOURNAL Cell Tissue Res 344 (1), 41-50 (2011) PUBMED 21287204 REMARK GeneRIF: In contrast to PC12 cells and the pancreatic beta cell line INS-1, Syt9 was not immunodetected in large dense-core vesicles in rat chromaffin cells. REFERENCE 4 (bases 1 to 1506) AUTHORS Zhang Z, Hui E, Chapman ER and Jackson MB. TITLE Regulation of exocytosis and fusion pores by synaptotagmin-effector interactions JOURNAL Mol Biol Cell 21 (16), 2821-2831 (2010) PUBMED 20573977 REMARK GeneRIF: Data show that Syt I produced more rapid dilation of fusion pores than syt VII or syt IX, consistent with its role in synchronous synaptic release. REFERENCE 5 (bases 1 to 1506) AUTHORS Gauthier BR and Wollheim CB. TITLE Synaptotagmins bind calcium to release insulin JOURNAL Am J Physiol Endocrinol Metab 295 (6), E1279-E1286 (2008) PUBMED 18713958 REMARK Review article REFERENCE 6 (bases 1 to 1506) AUTHORS Fukuda M. TITLE RNA interference-mediated silencing of synaptotagmin IX, but not synaptotagmin I, inhibits dense-core vesicle exocytosis in PC12 cells JOURNAL Biochem J 380 (Pt 3), 875-879 (2004) PUBMED 15015935 REFERENCE 7 (bases 1 to 1506) AUTHORS Tucker WC, Edwardson JM, Bai J, Kim HJ, Martin TF and Chapman ER. TITLE Identification of synaptotagmin effectors via acute inhibition of secretion from cracked PC12 cells JOURNAL J Cell Biol 162 (2), 199-209 (2003) PUBMED 12860971 REFERENCE 8 (bases 1 to 1506) AUTHORS Fukuda M, Kowalchyk JA, Zhang X, Martin TF and Mikoshiba K. TITLE Synaptotagmin IX regulates Ca2+-dependent secretion in PC12 cells JOURNAL J Biol Chem 277 (7), 4601-4604 (2002) PUBMED 11751925 REFERENCE 9 (bases 1 to 1506) AUTHORS Fukuda M, Kanno E and Mikoshiba K. TITLE Conserved N-terminal cysteine motif is essential for homo- and heterodimer formation of synaptotagmins III, V, VI, and X JOURNAL J Biol Chem 274 (44), 31421-31427 (1999) PUBMED 10531343 REFERENCE 10 (bases 1 to 1506) AUTHORS Li C, Ullrich B, Zhang JZ, Anderson RG, Brose N and Sudhof TC. TITLE Ca(2+)-dependent and -independent activities of neural and non-neural synaptotagmins JOURNAL Nature 375 (6532), 594-599 (1995) PUBMED 7791877 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AF375461.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AF375461.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMD00132261, SAMD00132262 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1506 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="1" /map="1q33" gene 1..1506 /gene="Syt9" /gene_synonym="Sytv" /note="synaptotagmin 9" /db_xref="GeneID:60564" /db_xref="RGD:621169" CDS 1..1476 /gene="Syt9" /gene_synonym="Sytv" /note="sytIX; synaptotagmin 5; synaptotagmin V; synaptogamin V; synaptotagmin IX" /codon_start=1 /product="synaptotagmin-9" /protein_id="NP_445776.1" /db_xref="GeneID:60564" /db_xref="RGD:621169" /translation="
MPGARDALCHQALQLLAELCARGALEHDSCQDFIYHLRDRARPRLRDPDISVSLLTLVVTACGLALFGVSLFVSWKLCWVPWRERGLFSGSKDNNQEPLNYTDTETNEQENSEDFLDPPTPCPDSSMKISHTSPDIPLSTQPGGQDNCAHAVRVQRQVTEPTPSARHNSIRRQLNLSNPDFNIQQLQRQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDFSGTSDPYVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVHYNDLEARKLHFSVYDFDRFSRHDLIGQVVVDHFFDLADFPRECILWKDIEYVTNDNVDLGELMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPESIDQIHLSIAVMDYDRVGHNEVIGVCQVGNEAERLGRDHWSEMLSYPRKPIAHWHSLLEKR"
misc_feature 25..93 /gene="Syt9" /gene_synonym="Sytv" /note="propagated from UniProtKB/Swiss-Prot (Q925C0.1); Region: Cysteine motif. /evidence=ECO:0000250|UniProtKB:O35681" misc_feature 157..219 /gene="Syt9" /gene_synonym="Sytv" /note="propagated from UniProtKB/Swiss-Prot (Q925C0.1); transmembrane region" misc_feature 271..441 /gene="Syt9" /gene_synonym="Sytv" /note="propagated from UniProtKB/Swiss-Prot (Q925C0.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 529..531 /gene="Syt9" /gene_synonym="Sytv" /note="Phosphoserine. /evidence=ECO:0007744|PubMed:22673903; propagated from UniProtKB/Swiss-Prot (Q925C0.1); phosphorylation site" misc_feature 661..1035 /gene="Syt9" /gene_synonym="Sytv" /note="C2 domain; Region: C2; cl14603" /db_xref="CDD:449331" misc_feature 1060..1461 /gene="Syt9" /gene_synonym="Sytv" /note="C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10; Region: C2B_Synaptotagmin-3-5-6-9-10; cd08403" /db_xref="CDD:176048" misc_feature order(1147..1149,1165..1167,1237..1239,1327..1329, 1333..1335,1351..1353) /gene="Syt9" /gene_synonym="Sytv" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:176048" exon 1..145 /gene="Syt9" /gene_synonym="Sytv" /inference="alignment:Splign:2.1.0" exon 146..497 /gene="Syt9" /gene_synonym="Sytv" /inference="alignment:Splign:2.1.0" exon 498..1044 /gene="Syt9" /gene_synonym="Sytv" /inference="alignment:Splign:2.1.0" exon 1045..1165 /gene="Syt9" /gene_synonym="Sytv" /inference="alignment:Splign:2.1.0" exon 1166..1337 /gene="Syt9" /gene_synonym="Sytv" /inference="alignment:Splign:2.1.0" exon 1338..1467 /gene="Syt9" /gene_synonym="Sytv" /inference="alignment:Splign:2.1.0" exon 1468..1506 /gene="Syt9" /gene_synonym="Sytv" /inference="alignment:Splign:2.1.0" ORIGIN
atgcccggggccagggacgcgctctgtcaccaggcgctgcagctgctggccgagctctgtgcccgaggggccctggagcacgacagctgccaagatttcatctaccacctgcgggaccgtgccagaccccggctccgcgacccagatatctctgtgagcctgctaactctcgtggttaccgcctgtggtcttgccctctttggtgtctctcttttcgtgtcttggaaactgtgctgggttccgtggcgagagcgaggcctgttctctggtagcaaagacaacaaccaagagcctcttaactacactgatacagagacaaatgagcaggagaacagcgaggacttcctagacccacccacaccctgcccggactcctccatgaagatcagccacacttcccccgacattcccctctccacccagccaggtggccaggacaactgtgcccatgccgtccgtgtacagcgacaagtcacagagccaacgccgtcagctcggcataactcaatccgaagacaactcaacctgtcaaacccggactttaatatccaacagcttcagaggcaggagcagttgactgggattggtagaattaagccagagttatataaacagaggtcactggacaacgacgatgggaggagaagtaacagcaaagcctgcgggaaactgaacttcatcttaaaatacgactgcgacttggaacagctcatcgtgaagatccacaaagccgtcaatctgcccgccaaggacttctctgggacgtcagatccttatgtcaagatctacttgcttcctgaccggaaaacaaaacaccagactaaggttcacaggaagaccctgaaccctgtgtttgacgaggtgtttttatttcctgtgcactacaatgaccttgaagctcggaagcttcacttctccgtgtatgactttgacaggttctctcgccatgacttgattggtcaagtggtggtggaccacttcttcgacttggctgacttccccagggagtgcatcctttggaaggatatcgagtatgtcaccaacgataatgtggacctgggtgagcttatgttttcgctctgctatcttccaacagccggcaggctgaccatcaccatcatcaaagcaaggaatttaaaggcaatggacattacgggagcgtcagatccgtacgtgaaagtctcactgatgtgtgatggccggagactgaagaagaggaaaacatccaccaagaggaacacgcttaaccctgtttacaatgaagccatagtcttcgatgtccctcctgagagcattgatcagatccacttgtccatagctgtcatggactatgaccgtgtaggtcacaatgaggtcatcggcgtgtgccaagtaggcaacgaggctgagcggctgggcagagaccactggagtgagatgctgtcatatccccgaaagcccatcgcacactggcactctctgctggagaaacgatgattgtggataggaagactgcttttgccaagg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]