LOCUS       NM_052981               1230 bp    mRNA    linear   ROD 01-APR-2024
DEFINITION  Rattus norvegicus cyclin H (Ccnh), mRNA.
ACCESSION   NM_052981
VERSION     NM_052981.4
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1230)
  AUTHORS   Wang,K.C., Nguyen,P., Weiss,A., Yeh,Y.T., Chien,H.S., Lee,A.,
            Teng,D., Subramaniam,S., Li,Y.S. and Chien,S.
  TITLE     MicroRNA-23b regulates cyclin-dependent kinase-activating kinase
            complex through cyclin H repression to modulate endothelial
            transcription and growth under flow
  JOURNAL   Arterioscler Thromb Vasc Biol 34 (7), 1437-1445 (2014)
   PUBMED   24855060
  REMARK    GeneRIF: Hemodynamic forces modulate EC proliferative phenotype
            through the miR-23b/CAK/cyclin H pathway.
REFERENCE   2  (bases 1 to 1230)
  AUTHORS   Wang,Y., Liu,F., Mao,F., Hang,Q., Huang,X., He,S., Wang,Y.,
            Cheng,C., Wang,H., Xu,G., Zhang,T. and Shen,A.
  TITLE     Interaction with cyclin H/cyclin-dependent kinase 7 (CCNH/CDK7)
            stabilizes C-terminal binding protein 2 (CtBP2) and promotes cancer
            cell migration
  JOURNAL   J Biol Chem 288 (13), 9028-9034 (2013)
   PUBMED   23393140
REFERENCE   3  (bases 1 to 1230)
  AUTHORS   Fujii,W., Nishimura,T., Kano,K., Sugiura,K. and Naito,K.
  TITLE     CDK7 and CCNH are components of CDK-activating kinase and are
            required for meiotic progression of pig oocytes
  JOURNAL   Biol Reprod 85 (6), 1124-1132 (2011)
   PUBMED   21778139
REFERENCE   4  (bases 1 to 1230)
  AUTHORS   Wu,G., Cao,J., Peng,C., Yang,H., Cui,Z., Zhao,J., Wu,Q., Han,J.,
            Li,H., Gu,X. and Zhang,F.
  TITLE     Temporal and spatial expression of cyclin H in rat spinal cord
            injury
  JOURNAL   Neuromolecular Med 13 (3), 187-196 (2011)
   PUBMED   21710280
  REMARK    GeneRIF: Data suggest that cyclin H may play a proliferative role
            in spinal cord injury (SCI).
REFERENCE   5  (bases 1 to 1230)
  AUTHORS   Egly,J.M. and Coin,F.
  TITLE     A history of TFIIH: two decades of molecular biology on a pivotal
            transcription/repair factor
  JOURNAL   DNA Repair (Amst) 10 (7), 714-721 (2011)
   PUBMED   21592869
  REMARK    Review article
REFERENCE   6  (bases 1 to 1230)
  AUTHORS   Laes,J.F., Quan,X., Ravoet,M., Stieber,D., Van Vooren,P., Van
            Reeth,T., Szpirer,J. and Szpirer,C.
  TITLE     Analysis of candidate genes included in the mammary cancer
            susceptibility 1 (Mcs1) region
  JOURNAL   Mamm Genome 12 (3), 199-206 (2001)
   PUBMED   11252168
REFERENCE   7  (bases 1 to 1230)
  AUTHORS   Jin,K., Nagayama,T., Chen,J., Stetler,A.R., Kawaguchi,K.,
            Simon,R.P. and Graham,S.H.
  TITLE     Molecular cloning of a cell cycle regulation gene cyclin H from
            ischemic rat brain: expression in neurons after global cerebral
            ischemia
  JOURNAL   J Neurochem 73 (4), 1598-1608 (1999)
   PUBMED   10501206
REFERENCE   8  (bases 1 to 1230)
  AUTHORS   Kershnar,E., Wu,S.Y. and Chiang,C.M.
  TITLE     Immunoaffinity purification and functional characterization of
            human transcription factor IIH and RNA polymerase II from clonal
            cell lines that conditionally express epitope-tagged subunits of
            the multiprotein complexes
  JOURNAL   J Biol Chem 273 (51), 34444-34453 (1998)
   PUBMED   9852112
REFERENCE   9  (bases 1 to 1230)
  AUTHORS   Drapkin,R., Le Roy,G., Cho,H., Akoulitchev,S. and Reinberg,D.
  TITLE     Human cyclin-dependent kinase-activating kinase exists in three
            distinct complexes
  JOURNAL   Proc Natl Acad Sci U S A 93 (13), 6488-6493 (1996)
   PUBMED   8692842
REFERENCE   10 (bases 1 to 1230)
  AUTHORS   Reardon,J.T., Ge,H., Gibbs,E., Sancar,A., Hurwitz,J. and Pan,Z.Q.
  TITLE     Isolation and characterization of two human transcription factor
            IIH (TFIIH)-related complexes: ERCC2/CAK and TFIIH
  JOURNAL   Proc Natl Acad Sci U S A 93 (13), 6482-6487 (1996)
   PUBMED   8692841
  REMARK    Erratum:[Proc Natl Acad Sci U S A 1996 Sep 17;93(19):10538]
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAXUCZ010000002.1.
            
            On Jun 1, 2021 this sequence version replaced NM_052981.3.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC059109.1, AF154914.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760383, SAMEA5760386
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-246               JAXUCZ010000002.1  17570494-17570739
            247-369             JAXUCZ010000002.1  17571826-17571948
            370-443             JAXUCZ010000002.1  17576936-17577009
            444-654             JAXUCZ010000002.1  17578091-17578301
            655-818             JAXUCZ010000002.1  17582939-17583102
            819-889             JAXUCZ010000002.1  17585939-17586009
            890-1001            JAXUCZ010000002.1  17589521-17589632
            1002-1062           JAXUCZ010000002.1  17589982-17590042
            1063-1230           JAXUCZ010000002.1  17590911-17591078
FEATURES             Location/Qualifiers
     source          1..1230
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="2"
                     /map="2q11"
     gene            1..1230
                     /gene="Ccnh"
                     /note="cyclin H"
                     /db_xref="GeneID:84389"
                     /db_xref="RGD:69419"
     exon            1..246
                     /gene="Ccnh"
                     /inference="alignment:Splign:2.1.0"
     CDS             130..1101
                     /gene="Ccnh"
                     /codon_start=1
                     /product="cyclin-H"
                     /protein_id="NP_443213.3"
                     /db_xref="GeneID:84389"
                     /db_xref="RGD:69419"
                     /translation="

MYHNSSQKRHWTFASEEQLARLRADANRKFKCKAVANGKVLPNDPLFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDIKTRYPMLENPEILRKTADDFLSRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAILKQKLERCHSSDLALNMVTKKRKGYEDDDYVSKKPKQEEEEWTDDDLVDAL"

     misc_feature    133..1053
                     /gene="Ccnh"
                     /note="cyclin ccl1; Region: ccl1; TIGR00569"
                     /db_xref="CDD:129660"
     misc_feature    142..144
                     /gene="Ccnh"
                     /note="Phosphoserine, by CDK8.
                     /evidence=ECO:0000250|UniProtKB:P51946; propagated from
                     UniProtKB/Swiss-Prot (Q9R1A0.2); phosphorylation site"
     misc_feature    523..525
                     /gene="Ccnh"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P51946; propagated from
                     UniProtKB/Swiss-Prot (Q9R1A0.2); phosphorylation site"
     misc_feature    1015..1098
                     /gene="Ccnh"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9R1A0.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    1039..1041
                     /gene="Ccnh"
                     /note="Phosphoserine, by CDK8.
                     /evidence=ECO:0000250|UniProtKB:P51946; propagated from
                     UniProtKB/Swiss-Prot (Q9R1A0.2); phosphorylation site"
     misc_feature    1072..1074
                     /gene="Ccnh"
                     /note="Phosphothreonine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (Q9R1A0.2); phosphorylation site"
     exon            247..369
                     /gene="Ccnh"
                     /inference="alignment:Splign:2.1.0"
     exon            370..443
                     /gene="Ccnh"
                     /inference="alignment:Splign:2.1.0"
     exon            444..654
                     /gene="Ccnh"
                     /inference="alignment:Splign:2.1.0"
     exon            655..818
                     /gene="Ccnh"
                     /inference="alignment:Splign:2.1.0"
     exon            819..889
                     /gene="Ccnh"
                     /inference="alignment:Splign:2.1.0"
     exon            890..1001
                     /gene="Ccnh"
                     /inference="alignment:Splign:2.1.0"
     exon            1002..1062
                     /gene="Ccnh"
                     /inference="alignment:Splign:2.1.0"
     exon            1063..1230
                     /gene="Ccnh"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

gtgaccgtgacgtcacgcgcgcgcctgcggtctgggccgagggttctcgcgttggcagtcgctcgtggctgctgtctcccggagtgtcgctgtttctgtctcggccctgcggcccgtgagggctacagcatgtaccacaacagcagccagaagcggcactggaccttcgctagcgaggagcaactggcgcgtctgcgggccgacgccaaccgcaaattcaagtgcaaagctgtggctaacgggaaggttcttccaaatgatccgttgtttcttgagcctcatgaagaaatgacactttgcaaatactatgaaaaaagattgttggaattttgttcagtgtttaaaccagctatgccacggtctgttgtgggtacagcttgtatgtatttcaagcgtttttatcttaataactcagtaatggaatatcaccctcggataataatgcttacttgtgcatttttggcctgcaaagtagatgaattcaatgtgtctagtcctcagtttgttgggaaccttcgagagagtcctcttggacaggagaaggcactggaacagattttggaatatgaactactacttatacaacaacttaattttcacctcattgtccacaatccatatagaccatttgaaggcttcctcattgatataaagactcgataccccatgttggagaatccagagattttgaggaaaacggctgatgattttcttagtagaattgcattgacagatgcttatcttttgtacacaccctcacaaattgccctgactgccattttatcaagtgcctctagggctggaattactatggaaagctatttatcagagagtctaatgctgaaagaaaacagaacttgcctgtcacagctactggatataatgaaaagcatgagaaatctagtaaaaaagtatgagccacccagatctgaagaagttgctattctgaaacagaagttggagcgatgtcattcttctgaccttgcacttaatatggttacaaagaagaggaaaggctacgaagacgatgactatgtatcaaagaaacccaaacaggaagaggaggagtggacggacgatgacctggtagatgctctctaaccagtgtaaatgactgcagcagtacttactgaccgacggaagtaggaagcatgtctgacattttacttttgtcaaaatagtgcaatgtgaaaacatcaaaatatattaaacttttctaattcttatata

//