2024-05-02 06:46:36, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_031050 1728 bp mRNA linear ROD 21-NOV-2023 DEFINITION Rattus norvegicus lumican (Lum), mRNA. ACCESSION NM_031050 VERSION NM_031050.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1728) AUTHORS Hayes AJ and Melrose J. TITLE Immunolocalization of Keratan Sulfate in Rat Spinal Tissues Using the Keratanase Generated BKS-1(+) Neoepitope: Correlation of Expression Patterns with the Class II SLRPs, Lumican and Keratocan JOURNAL Cells 9 (4), 826 (2020) PUBMED 32235499 REMARK GeneRIF: Immunolocalization of Keratan Sulfate in Rat Spinal Tissues Using the Keratanase Generated BKS-1(+) Neoepitope: Correlation of Expression Patterns with the Class II SLRPs, Lumican and Keratocan. Publication Status: Online-Only REFERENCE 2 (bases 1 to 1728) AUTHORS Barallobre-Barreiro J, Gupta SK, Zoccarato A, Kitazume-Taneike R, Fava M, Yin X, Werner T, Hirt MN, Zampetaki A, Viviano A, Chong M, Bern M, Kourliouros A, Domenech N, Willeit P, Shah AM, Jahangiri M, Schaefer L, Fischer JW, Iozzo RV, Viner R, Thum T, Heineke J, Kichler A, Otsu K and Mayr M. TITLE Glycoproteomics Reveals Decorin Peptides With Anti-Myostatin Activity in Human Atrial Fibrillation JOURNAL Circulation 134 (11), 817-832 (2016) PUBMED 27559042 REFERENCE 3 (bases 1 to 1728) AUTHORS Barallobre-Barreiro J, Oklu R, Lynch M, Fava M, Baig F, Yin X, Barwari T, Potier DN, Albadawi H, Jahangiri M, Porter KE, Watkins MT, Misra S, Stoughton J and Mayr M. TITLE Extracellular matrix remodelling in response to venous hypertension: proteomics of human varicose veins JOURNAL Cardiovasc Res 110 (3), 419-430 (2016) PUBMED 27068509 REFERENCE 4 (bases 1 to 1728) AUTHORS Abonnenc M, Nabeebaccus AA, Mayr U, Barallobre-Barreiro J, Dong X, Cuello F, Sur S, Drozdov I, Langley SR, Lu R, Stathopoulou K, Didangelos A, Yin X, Zimmermann WH, Shah AM, Zampetaki A and Mayr M. TITLE Extracellular matrix secretion by cardiac fibroblasts: role of microRNA-29b and microRNA-30c JOURNAL Circ Res 113 (10), 1138-1147 (2013) PUBMED 24006456 REFERENCE 5 (bases 1 to 1728) AUTHORS Bubenek S, Nastase A, Niculescu AM, Baila S, Herlea V, Lazar V, Paslaru L, Botezatu A, Tomescu D, Popescu I and Dima S. TITLE Assessment of gene expression profiles in peripheral occlusive arterial disease JOURNAL Can J Cardiol 28 (6), 712-720 (2012) PUBMED 22721676 REFERENCE 6 (bases 1 to 1728) AUTHORS Onda M, Ishiwata T, Kawahara K, Wang R, Naito Z and Sugisaki Y. TITLE Expression of lumican in thickened intima and smooth muscle cells in human coronary atherosclerosis JOURNAL Exp Mol Pathol 72 (2), 142-149 (2002) PUBMED 11890723 REFERENCE 7 (bases 1 to 1728) AUTHORS Baba H, Ishiwata T, Takashi E, Xu G and Asano G. TITLE Expression and localization of lumican in the ischemic and reperfused rat heart JOURNAL Jpn Circ J 65 (5), 445-450 (2001) PUBMED 11348051 REFERENCE 8 (bases 1 to 1728) AUTHORS Neame PJ, Kay CJ, McQuillan DJ, Beales MP and Hassell JR. TITLE Independent modulation of collagen fibrillogenesis by decorin and lumican JOURNAL Cell Mol Life Sci 57 (5), 859-863 (2000) PUBMED 10892350 REFERENCE 9 (bases 1 to 1728) AUTHORS Svensson L, Narlid I and Oldberg A. TITLE Fibromodulin and lumican bind to the same region on collagen type I fibrils JOURNAL FEBS Lett 470 (2), 178-182 (2000) PUBMED 10734230 REFERENCE 10 (bases 1 to 1728) AUTHORS Krull NB and Gressner AM. TITLE Differential expression of keratan sulphate proteoglycans fibromodulin, lumican and aggrecan in normal and fibrotic rat liver JOURNAL FEBS Lett 312 (1), 47-52 (1992) PUBMED 1385211 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from JACYVU010000185.1. On Nov 26, 2020 this sequence version replaced NM_031050.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: X84039.1, BC061878.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5756307, SAMEA5760384 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-24 JACYVU010000185.1 14989370-14989393 25-907 JACYVU010000185.1 14991746-14992628 908-1728 JACYVU010000185.1 14995354-14996174 FEATURES Location/Qualifiers source 1..1728 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="7" /map="7q13" gene 1..1728 /gene="Lum" /note="lumican" /db_xref="GeneID:81682" /db_xref="RGD:620984" exon 1..24 /gene="Lum" /inference="alignment:Splign:2.1.0" exon 25..907 /gene="Lum" /inference="alignment:Splign:2.1.0" CDS 46..1062 /gene="Lum" /note="KSPG lumican; keratan sulfate proteoglycan lumican" /codon_start=1 /product="lumican precursor" /protein_id="NP_112312.1" /db_xref="GeneID:81682" /db_xref="RGD:620984" /translation="
MNVCTFTLVLALVGSVSGQYYDYDAPLFMYGELSPNCAPECNCPHSYPTAMYCDDLKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKKLHINYNNLTESVGPLPKSLQDLQLANNKISKLGSFDGLVNLTFIYLQHNQLKEEAVSASLKGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKITNIPDEYFNRFTGLQYLRLSHNELADSGVPGNSFNISSLLELDLSYNKLKSIPTVNENLENYYLEVNKLEKFDVKSFCKILGPLSYSKIKHLRLDGNPLTQSSLPPDMYECLRVANEITVN"
sig_peptide 46..99 /gene="Lum" /inference="COORDINATES: ab initio prediction:SignalP:4.0" mat_peptide 100..1059 /gene="Lum" /product="Lumican. /id=PRO_0000032735" /note="propagated from UniProtKB/Swiss-Prot (P51886.1)" misc_feature 100..102 /gene="Lum" /note="Pyrrolidone carboxylic acid. /evidence=ECO:0000250|UniProtKB:P51884; propagated from UniProtKB/Swiss-Prot (P51886.1); pyrrolidone-carboxylic-acid site" misc_feature 103..105 /gene="Lum" /note="Sulfotyrosine. /evidence=ECO:0000250|UniProtKB:P51885; propagated from UniProtKB/Swiss-Prot (P51886.1); sulfatation site" misc_feature 106..108 /gene="Lum" /note="Sulfotyrosine. /evidence=ECO:0000250|UniProtKB:P51885; propagated from UniProtKB/Swiss-Prot (P51886.1); sulfatation site" misc_feature 112..114 /gene="Lum" /note="Sulfotyrosine. /evidence=ECO:0000250|UniProtKB:P51885; propagated from UniProtKB/Swiss-Prot (P51886.1); sulfatation site" misc_feature 133..135 /gene="Lum" /note="Sulfotyrosine. /evidence=ECO:0000250|UniProtKB:P51885; propagated from UniProtKB/Swiss-Prot (P51886.1); sulfatation site" misc_feature <175..>771 /gene="Lum" /note="type III secretion system effector E3 ubiquitin transferase SlrP; Region: PRK15370" /db_xref="CDD:185268" misc_feature 244..309 /gene="Lum" /note="propagated from UniProtKB/Swiss-Prot (P51886.1); Region: LRR 1" misc_feature 247..318 /gene="Lum" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275380" misc_feature 307..309 /gene="Lum" /note="N-linked (GlcNAc...) (keratan sulfate) asparagine. /evidence=ECO:0000255; propagated from UniProtKB/Swiss-Prot (P51886.1); glycosylation site" misc_feature 316..387 /gene="Lum" /note="propagated from UniProtKB/Swiss-Prot (P51886.1); Region: LRR 2" misc_feature 319..396 /gene="Lum" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275380" misc_feature 394..456 /gene="Lum" /note="propagated from UniProtKB/Swiss-Prot (P51886.1); Region: LRR 3" misc_feature 397..459 /gene="Lum" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275380" misc_feature 424..426 /gene="Lum" /note="N-linked (GlcNAc...) (keratan sulfate) asparagine. /evidence=ECO:0000255; propagated from UniProtKB/Swiss-Prot (P51886.1); glycosylation site" misc_feature 457..522 /gene="Lum" /note="propagated from UniProtKB/Swiss-Prot (P51886.1); Region: LRR 4" misc_feature 460..525 /gene="Lum" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275380" misc_feature 523..588 /gene="Lum" /note="propagated from UniProtKB/Swiss-Prot (P51886.1); Region: LRR 5" misc_feature 523..525 /gene="Lum" /note="N-linked (GlcNAc...) (keratan sulfate) asparagine. /evidence=ECO:0000255; propagated from UniProtKB/Swiss-Prot (P51886.1); glycosylation site" misc_feature 526..600 /gene="Lum" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275380" misc_feature 598..660 /gene="Lum" /note="propagated from UniProtKB/Swiss-Prot (P51886.1); Region: LRR 6" misc_feature 601..663 /gene="Lum" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275380" misc_feature 661..726 /gene="Lum" /note="propagated from UniProtKB/Swiss-Prot (P51886.1); Region: LRR 7" misc_feature 664..735 /gene="Lum" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275380" misc_feature 733..795 /gene="Lum" /note="propagated from UniProtKB/Swiss-Prot (P51886.1); Region: LRR 8" misc_feature 736..810 /gene="Lum" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275380" misc_feature 799..801 /gene="Lum" /note="N-linked (GlcNAc...) (keratan sulfate) asparagine. /evidence=ECO:0000255; propagated from UniProtKB/Swiss-Prot (P51886.1); glycosylation site" misc_feature 808..873 /gene="Lum" /note="propagated from UniProtKB/Swiss-Prot (P51886.1); Region: LRR 9" misc_feature 871..960 /gene="Lum" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275380" misc_feature 874..933 /gene="Lum" /note="propagated from UniProtKB/Swiss-Prot (P51886.1); Region: LRR 10" misc_feature 955..957 /gene="Lum" /note="Phosphoserine. /evidence=ECO:0007744|PubMed:22673903; propagated from UniProtKB/Swiss-Prot (P51886.1); phosphorylation site" misc_feature 958..1023 /gene="Lum" /note="propagated from UniProtKB/Swiss-Prot (P51886.1); Region: LRR 11" misc_feature 961..1032 /gene="Lum" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275380" exon 908..1728 /gene="Lum" /inference="alignment:Splign:2.1.0" ORIGIN
cggaaacagtgtcaagagagtaagggcacagaggacttgctgaaaatgaatgtatgtacgttcactcttgtcttggcattagtcggtagtgtcagtggccaatactatgattatgatgcccctctcttcatgtatggggaactgtcacccaactgtgcaccagaatgtaactgtccccacagctacccaactgccatgtactgtgatgatctcaagttgaaaagtgtgcccatggtgccccctggcatcaagtacctttacctgaggaataaccagatcgaccatattgatgaaaaggcctttgagaatgtaacggatctgcagtggctcattcttgaccacaatcttctagaaaactccaagatcaaaggaaaggtcttctctaagctgaaacaactgaagaagctgcatataaactacaacaatttgaccgagtccgtgggtccgctcccaaagtccctacaagacctgcagctggccaataataagatcagcaagctgggctccttcgacgggctggtaaacctgaccttcatttaccttcaacacaaccagctcaaagaggaggctgtctcggcttctctgaaaggccttaagtcactcgaatacctcgacttgagcttcaatcagatgagcaagctgcccgctggccttccaacatctcttctaactctctacctagacaacaataagatcaccaacattcctgatgagtatttcaatcgcttcaccgggcttcaatacttgcgtttatctcacaatgagctggctgacagtggcgtgcctggaaactcatttaacatatcatctctgctcgagctcgatctctcctacaataagctcaagagtataccaaccgttaatgaaaaccttgaaaactattacctggaggtcaataaactcgaaaagtttgatgtcaagagcttctgtaagatcctgggaccactatcttactccaagatcaagcatttgcgcttggatggcaatcccctcactcaaagcagtctgccccctgacatgtacgagtgtctacgtgtagcaaatgaaatcacggttaattaacctcctctcattctaatacattgaagtatgttccagagcagtacttcatggatgggtatttgctggatgtgttaaagttttcacaatatcctttacattgttattgtcattgttgttgttggtattacttcatggattttaattaataaaggaaatgttttgtgaacatttaccactttttaaataaaagatgaaaagcaggcctatttcatcgtgagaacagacacataaaacccgttaaacttaagtctatttgtgaatttaatgttttctatagctctatgttcaggtgattatgaagcctttttactgattgcttggaagtccaccaggtttctatggttcctcacattttacattagtgacttcgaaaacatgaaacaaacatgcatggatgtttgttatcctaatccaaatttttgtgacatgtcaagtttgttttacagaagtttagatcctatgttttgaaaccagtgatttgcaacataccaaagaaaattactaaagacctgtctacttaaagaaatgtagttagcagtaagaatttgcccagttacttaatgaaacttttcttgagtcattttcctgtcatatctatgtttctttctgattgtttgcatgttatgattaacaagctgatagcaaaataaaacaatgcaaatggta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]