2024-04-26 08:41:54, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_019381 898 bp mRNA linear ROD 08-NOV-2023 DEFINITION Rattus norvegicus transmembrane BAX inhibitor motif containing 6 (Tmbim6), mRNA. ACCESSION NM_019381 XM_001063712 XM_576343 VERSION NM_019381.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 898) AUTHORS Chen W, DU H, Sha Y, Zhou Y, Liang J, Chen Y, Ma Q, Wu X and Qian G. TITLE [Long noncoding RNA H19 promotes vascular calcification by repressing the Bax inhibitor 1/optic atrophy 1 pathway] JOURNAL Nan Fang Yi Ke Da Xue Xue Bao 43 (9), 1469-1475 (2023) PUBMED 37814860 REMARK GeneRIF: [Long noncoding RNA H19 promotes vascular calcification by repressing the Bax inhibitor 1/optic atrophy 1 pathway]. REFERENCE 2 (bases 1 to 898) AUTHORS Chen Y, Liu X, Li L, He X, Zheng F, Zhang Y, Gao H, Jin Z, Wu D, Wang Q, Tao H, Zhao Y, Liu W and Zou L. TITLE Methyltransferase-like 3 aggravates endoplasmic reticulum stress in preeclampsia by targeting TMBIM6 in YTHDF2-dependent manner JOURNAL Mol Med 29 (1), 19 (2023) PUBMED 36747144 REMARK GeneRIF: Methyltransferase-like 3 aggravates endoplasmic reticulum stress in preeclampsia by targeting TMBIM6 in YTHDF2-dependent manner. Publication Status: Online-Only REFERENCE 3 (bases 1 to 898) AUTHORS Liu J, Zhou S, Zhang Y, Li X, Qian X, Tao W, Jin L and Zhao J. TITLE Bax inhibitor-1 suppresses early brain injury following experimental subarachnoid hemorrhage in rats JOURNAL Int J Mol Med 42 (5), 2891-2902 (2018) PUBMED 30226536 REMARK GeneRIF: The present study suggested that Bax inhibitor-1 serves a neuroprotective role in Early brain injury following subarachnoid hemorrhage by attenuating bloodbrain barrier disruption, brain edema and apoptosis mediated by endoplasmic reticulum stress. REFERENCE 4 (bases 1 to 898) AUTHORS Liu J, Zhou S, Qian X, Zhang Y and Zhao J. TITLE [Over-expressed Bax inhibitor 1 (BI-1) inhibits apoptosis of hippocampal neurons via endoplasmic reticulum IRE1-JNK pathway in rats with subarachnoid hemorrhage] JOURNAL Xi Bao Yu Fen Zi Mian Yi Xue Za Zhi 33 (10), 1316-1322 (2017) PUBMED 29169414 REMARK GeneRIF: Bax inhibitor-1 (BI-1) over-expression improved neurobehavioral score, decreased hippocampal neuron apoptosis rate, and also down-regulated IRE1 protein levels in the rats with subarachnoid hemorrhage (SAH). REFERENCE 5 (bases 1 to 898) AUTHORS Urresti J, Ruiz-Meana M, Coccia E, Arevalo JC, Castellano J, Fernandez-Sanz C, Galenkamp KM, Planells-Ferrer L, Moubarak RS, Llecha-Cano N, Reix S, Garcia-Dorado D, Barneda-Zahonero B and Comella JX. TITLE Lifeguard Inhibits Fas Ligand-mediated Endoplasmic Reticulum-Calcium Release Mandatory for Apoptosis in Type II Apoptotic Cells JOURNAL J Biol Chem 291 (3), 1221-1234 (2016) PUBMED 26582200 REFERENCE 6 (bases 1 to 898) AUTHORS Chae HJ, Kim HR, Xu C, Bailly-Maitre B, Krajewska M, Krajewski S, Banares S, Cui J, Digicaylioglu M, Ke N, Kitada S, Monosov E, Thomas M, Kress CL, Babendure JR, Tsien RY, Lipton SA and Reed JC. TITLE BI-1 regulates an apoptosis pathway linked to endoplasmic reticulum stress JOURNAL Mol Cell 15 (3), 355-366 (2004) PUBMED 15304216 REFERENCE 7 (bases 1 to 898) AUTHORS Grzmil M, Thelen P, Hemmerlein B, Schweyer S, Voigt S, Mury D and Burfeind P. TITLE Bax inhibitor-1 is overexpressed in prostate cancer and its specific down-regulation by RNA interference leads to cell death in human prostate carcinoma cells JOURNAL Am J Pathol 163 (2), 543-552 (2003) PUBMED 12875974 REFERENCE 8 (bases 1 to 898) AUTHORS Jean JC, Oakes SM and Joyce-Brady M. TITLE The Bax inhibitor-1 gene is differentially regulated in adult testis and developing lung by two alternative TATA-less promoters JOURNAL Genomics 57 (2), 201-208 (1999) PUBMED 10198159 REFERENCE 9 (bases 1 to 898) AUTHORS Xu Q and Reed JC. TITLE Bax inhibitor-1, a mammalian apoptosis suppressor identified by functional screening in yeast JOURNAL Mol Cell 1 (3), 337-346 (1998) PUBMED 9660918 REFERENCE 10 (bases 1 to 898) AUTHORS Walter L, Dirks B, Rothermel E, Heyens M, Szpirer C, Levan G and Gunther E. TITLE A novel, conserved gene of the rat that is developmentally regulated in the testis JOURNAL Mamm Genome 5 (4), 216-221 (1994) PUBMED 8012111 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC058478.1. On or before Jan 28, 2007 this sequence version replaced XM_576343.2, XM_001063712.1, NM_019381.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC058478.1, FQ218441.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMD00132261, SAMD00132262 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-898 BC058478.1 7-904 FEATURES Location/Qualifiers source 1..898 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="7" /map="7q36" gene 1..898 /gene="Tmbim6" /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt" /note="transmembrane BAX inhibitor motif containing 6" /db_xref="GeneID:24822" /db_xref="RGD:3842" exon 1..53 /gene="Tmbim6" /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt" /inference="alignment:Splign:2.1.0" misc_feature 47..49 /gene="Tmbim6" /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt" /note="upstream in-frame stop codon" exon 54..138 /gene="Tmbim6" /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt" /inference="alignment:Splign:2.1.0" CDS 83..796 /gene="Tmbim6" /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt" /note="testis enhanced gene transcript; Bax inhibitor-1; BI-1; testis-enhanced gene transcript protein; transmembrane BAX inhibitor motif-containing protein 6" /codon_start=1 /product="bax inhibitor 1" /protein_id="NP_062254.2" /db_xref="GeneID:24822" /db_xref="RGD:3842" /translation="
MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTRFIQAGLLSALGALALMICLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALELCIAINPSILPTAFMGTAMIFTCFSLSALYARRRSYLFLGGILMSAMSLMFVSSLGNLFFGSIWLFQANLYMGLLVMCGFVLFDTQLIIEKAEHGDKDYIWHCIDLFLDFVTLFRKLMLILAFNEKDKKKEKK"
misc_feature 128..766 /gene="Tmbim6" /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt" /note="BAX inhibitor (BI)-1; Region: BI-1; cd10430" /db_xref="CDD:198412" misc_feature 170..232 /gene="Tmbim6" /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt" /note="propagated from UniProtKB/Swiss-Prot (P55062.2); transmembrane region" misc_feature 239..301 /gene="Tmbim6" /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt" /note="propagated from UniProtKB/Swiss-Prot (P55062.2); transmembrane region" misc_feature 341..403 /gene="Tmbim6" /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt" /note="propagated from UniProtKB/Swiss-Prot (P55062.2); transmembrane region" misc_feature 419..481 /gene="Tmbim6" /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt" /note="propagated from UniProtKB/Swiss-Prot (P55062.2); transmembrane region" misc_feature 500..562 /gene="Tmbim6" /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt" /note="propagated from UniProtKB/Swiss-Prot (P55062.2); transmembrane region" misc_feature 581..643 /gene="Tmbim6" /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt" /note="propagated from UniProtKB/Swiss-Prot (P55062.2); transmembrane region" exon 139..247 /gene="Tmbim6" /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt" /inference="alignment:Splign:2.1.0" exon 248..368 /gene="Tmbim6" /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt" /inference="alignment:Splign:2.1.0" exon 369..417 /gene="Tmbim6" /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt" /inference="alignment:Splign:2.1.0" exon 418..515 /gene="Tmbim6" /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt" /inference="alignment:Splign:2.1.0" exon 516..595 /gene="Tmbim6" /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt" /inference="alignment:Splign:2.1.0" exon 596..696 /gene="Tmbim6" /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt" /inference="alignment:Splign:2.1.0" exon 697..772 /gene="Tmbim6" /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt" /inference="alignment:Splign:2.1.0" exon 773..898 /gene="Tmbim6" /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt" /inference="alignment:Splign:2.1.0" ORIGIN
agcacatccggttttagccgagcggggaagctccgaagaggtgggctaagaagcggaggctgcgctgaacagacttggagccatgaatatatttgatcggaagatcaactttgatgccctcttaaaattttcccacataactccctccacacagcagcacctaaagaaggtctatgccagttttgcactgtgcatgtttgtggcagcagcaggggcctatgtccatgtggtcacacgtttcatccaggctggcctgctctctgccctgggcgccctggccttgatgatttgcctgatggccacacctcacagccatgagacggagcagaagaggctgggactgctcgctggcttcgccttccttacaggagttggcctgggacctgccctggagctgtgcattgccatcaaccccagcatcctccccacggccttcatgggcacggccatgatcttcacctgcttcagcctgagtgccctctacgccaggcgccggagttacctctttttgggaggtatcttgatgtcagccatgagcctcatgttcgtgtcctctctggggaaccttttctttggatccatttggctgttccaggcaaacctgtacatggggctgctggtcatgtgcggctttgtcctcttcgacactcagctcattattgaaaaggctgaacacggagacaaggattacatctggcactgcattgacctcttcttggacttcgttacactcttcaggaagctcatgctgatcttggccttcaatgagaaggacaaaaagaaagagaagaagtgacgtggtgatcgatcggcctctcccagctcgccttctctccctcagccccgtttctttgcacacatcacaggtgtcgtgtcccatgacaatgaaaagcatcag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]