LOCUS       NM_012943               1390 bp    mRNA    linear   ROD 22-MAR-2023
DEFINITION  Rattus norvegicus distal-less homeobox 5 (Dlx5), mRNA.
ACCESSION   NM_012943
VERSION     NM_012943.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1390)
  AUTHORS   Li X, Wu Y, Xie F, Zhang F, Zhang S, Zhou J, Chen D and Liu A.
  TITLE     miR-339-5p negatively regulates loureirin A-induced hair follicle
            stem cell differentiation by targeting DLX5
  JOURNAL   Mol Med Rep 18 (2), 1279-1286 (2018)
   PUBMED   29901112
  REMARK    GeneRIF: these results suggest that miR3395p negatively regulated
            loureirin Ainduced HFSC differentiation by targeting DLX5,
            resulting in Wnt/betacatenin signaling pathway inhibition.
REFERENCE   2  (bases 1 to 1390)
  AUTHORS   Garaffo G, Conte D, Provero P, Tomaiuolo D, Luo Z, Pinciroli P,
            Peano C, D'Atri I, Gitton Y, Etzion T, Gothilf Y, Gays D, Santoro
            MM and Merlo GR.
  TITLE     The Dlx5 and Foxg1 transcription factors, linked via miRNA-9 and
            -200, are required for the development of the olfactory and GnRH
            system
  JOURNAL   Mol Cell Neurosci 68, 103-119 (2015)
   PUBMED   25937343
REFERENCE   3  (bases 1 to 1390)
  AUTHORS   Takai H, Mezawa M, Choe J, Nakayama Y and Ogata Y.
  TITLE     Osteogenic transcription factors and proto-oncogene regulate bone
            sialoprotein gene transcription
  JOURNAL   J Oral Sci 55 (3), 209-215 (2013)
   PUBMED   24042587
  REMARK    GeneRIF: results demonstrate that overexpression of Runx2, Dlx5 or
            c-Src stimulates BSP transcription, and suggest that Runx2, Dlx5
            and c-Src might be crucial transcriptional regulators of
            mineralization and bone formation
REFERENCE   4  (bases 1 to 1390)
  AUTHORS   Singh M, Del Carpio-Cano FE, Monroy MA, Popoff SN and Safadi FF.
  TITLE     Homeodomain transcription factors regulate BMP-2-induced
            osteoactivin transcription in osteoblasts
  JOURNAL   J Cell Physiol 227 (1), 390-399 (2012)
   PUBMED   21503878
  REMARK    GeneRIF: OA transcription is differentially regulated by Dlx3,
            Dlx5, and Msx2 during osteoblast differentiation.
REFERENCE   5  (bases 1 to 1390)
  AUTHORS   Hie M, Iitsuka N, Otsuka T, Nakanishi A and Tsukamoto I.
  TITLE     Zinc deficiency decreases osteoblasts and osteoclasts associated
            with the reduced expression of Runx2 and RANK
  JOURNAL   Bone 49 (6), 1152-1159 (2011)
   PUBMED   21893222
REFERENCE   6  (bases 1 to 1390)
  AUTHORS   Merlo GR, Paleari L, Mantero S, Genova F, Beverdam A, Palmisano GL,
            Barbieri O and Levi G.
  TITLE     Mouse model of split hand/foot malformation type I
  JOURNAL   Genesis 33 (2), 97-101 (2002)
   PUBMED   12112878
REFERENCE   7  (bases 1 to 1390)
  AUTHORS   Eisenstat DD, Liu JK, Mione M, Zhong W, Yu G, Anderson SA, Ghattas
            I, Puelles L and Rubenstein JL.
  TITLE     DLX-1, DLX-2, and DLX-5 expression define distinct stages of basal
            forebrain differentiation
  JOURNAL   J Comp Neurol 414 (2), 217-237 (1999)
   PUBMED   10516593
REFERENCE   8  (bases 1 to 1390)
  AUTHORS   Liu JK, Ghattas I, Liu S, Chen S and Rubenstein JL.
  TITLE     Dlx genes encode DNA-binding proteins that are expressed in an
            overlapping and sequential pattern during basal ganglia
            differentiation
  JOURNAL   Dev Dyn 210 (4), 498-512 (1997)
   PUBMED   9415433
REFERENCE   9  (bases 1 to 1390)
  AUTHORS   Shirasawa T, Sakamoto K and Tkahashi H.
  TITLE     Molecular cloning and evolutional analysis of a mammalian homologue
            of the Distal-less 3 (Dlx-3) homeobox gene
  JOURNAL   FEBS Lett 351 (3), 380-384 (1994)
   PUBMED   7915995
REFERENCE   10 (bases 1 to 1390)
  AUTHORS   Zhao GQ, Zhao S, Zhou X, Eberspaecher H, Solursh M and de
            Crombrugghe B.
  TITLE     rDlx, a novel distal-less-like homeoprotein is expressed in
            developing cartilages and discrete neuronal tissues
  JOURNAL   Dev Biol 164 (1), 37-51 (1994)
   PUBMED   7913069
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from L24443.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: L24443.1, D31734.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760396 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1390
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="Sprague-Dawley"
                     /db_xref="taxon:10116"
                     /chromosome="4"
                     /map="4q21"
     gene            1..1390
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /note="distal-less homeobox 5"
                     /db_xref="GeneID:25431"
                     /db_xref="RGD:2506"
     exon            1..533
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    155..157
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /note="upstream in-frame stop codon"
     CDS             179..1048
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /note="DLX-3; homeobox protein DLX-3"
                     /codon_start=1
                     /product="homeobox protein DLX-5"
                     /protein_id="NP_037075.1"
                     /db_xref="GeneID:25431"
                     /db_xref="RGD:2506"
                     /translation="

MTGVFDRRVPSIRSGDFQAPFPTSAAMHHPSQESPTLPESSATDSDYYSPAGAAPHGYCSPTSASYRKALNPYQYQYHSVNGSAAGYPAKAYADYGYASPYHQYGGAYNRVPSATSQPEKEVAEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPTTSNQSPASSYLENSASWYPSAASSINSHLPPPGSLQHPLALASGTLY"

     misc_feature    179..325
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /note="propagated from UniProtKB/Swiss-Prot (P50575.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    272..532
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /note="Homeobox protein distal-less-like N terminal;
                     Region: DLL_N; pfam12413"
                     /db_xref="CDD:432536"
     misc_feature    278..280
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /note="Phosphoserine, by MAPK14, in vitro.
                     /evidence=ECO:0000250|UniProtKB:P70396; propagated from
                     UniProtKB/Swiss-Prot (P50575.1); phosphorylation site"
     misc_feature    order(590..604,608..610,659..661,677..679,716..718,
                     722..727,734..739,743..751,755..760)
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    596..757
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(596..598,605..607,725..727,734..739,746..748)
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    770..937
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /note="propagated from UniProtKB/Swiss-Prot (P50575.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    827..829
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /note="Phosphoserine, by MAPK14, in vitro.
                     /evidence=ECO:0000250|UniProtKB:P70396; propagated from
                     UniProtKB/Swiss-Prot (P50575.1); phosphorylation site"
     misc_feature    986..1045
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /note="propagated from UniProtKB/Swiss-Prot (P50575.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            534..718
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /inference="alignment:Splign:2.1.0"
     exon            719..1390
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

gacagagcctccacgactcccagcctcctcctccccgccgccgccgccaccgccgccgcctcctcttcctcctcctcctccctcgctcccacagccatgtctgcttagaccagagcagctccacagccaattctggcagcagcggccgcctcaataggacagccaccgcccgggagctatgacaggagtgtttgacagaagagtcccaagcatccgatccggcgacttccaagctccgttcccgacgtccgccgccatgcaccacccgtctcaggaatcgccaactttgccggagtcctcggccaccgattctgactactacagtcccgcgggggccgcccctcatggctactgctctcctacctctgcttcttaccgcaaagcgctcaacccataccagtaccagtatcacagcgtgaacggctccgcagccggctacccggccaaggcttatgcggactacggctacgccagcccctaccaccagtacggaggcgcctacaaccgagtcccgagtgccaccagccagccagagaaagaagtggccgagccagaggtgaggatggtgaatggtaaaccaaagaaagttcgtaaacccaggactatttattccagctttcagctggccgctttacagagaaggtttcagaagactcagtacctcgccctgccagaacgcgcggagttggccgcctctctaggactgacgcaaacacaggtgaaaatctggtttcagaacaaaagatccaagatcaagaagatcatgaaaaacggggagatgcccccggagcacagtcccagctccagcgaccctatggcgtgtaactcgccacagtcaccagcggtgtgggagccccagggctcatcccgctctctcagccaccaccctcatgcccaccctacgacctccaaccagtcccccgcgtccagctacctggagaactcggcttcctggtacccaagtgcagccagctcaatcaattcccacctgccaccgcctggctccctgcagcacccgctggcactggcctccgggacgctttattagatgggctactctctcttgctcagttttgggactacagtgttttcctgttttagaaatcagaaagaaaggaattcatacggggatgtttgaacaatggaaacaaagattcatgtgtaaagctttttttttgcatgtaagttattgcatttcaaaggaccccgcccctttttttacgaaaagaacccttttttgcgcaactgtggacactatcaatggtgccttgaaatctatgacctcaacttttcaaaaagacttttttcaatgttattttaaccgtgtaaataagtgtagatagaggaattaaactgtatattctggataaataaaattatttcgaccatg

//