2024-05-06 18:58:30, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001399019 2256 bp mRNA linear ROD 23-MAR-2023 DEFINITION Rattus norvegicus autophagy related 5 (Atg5), transcript variant 2, mRNA. ACCESSION NM_001399019 XM_039098916 VERSION NM_001399019.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 2256) AUTHORS Cai X, Zhang P, Yang Y, Wang Y, Zhu H, Li B, Zeng H, Hong L and Shao L. TITLE MiR-30a-5p Promotes Vein Graft Restenosis by Inhibiting Cell Autophagy through Targeting ATG5 JOURNAL Curr Med Chem 30 (6), 757-774 (2023) PUBMED 35927903 REMARK GeneRIF: MiR-30a-5p Promotes Vein Graft Restenosis by Inhibiting Cell Autophagy through Targeting ATG5. REFERENCE 2 (bases 1 to 2256) AUTHORS Tsujimoto R, Yurube T, Takeoka Y, Kanda Y, Miyazaki K, Ohnishi H, Kakiuchi Y, Miyazaki S, Zhang Z, Takada T, Kuroda R and Kakutani K. TITLE Involvement of autophagy in the maintenance of rat intervertebral disc homeostasis: an in-vitro and in-vivo RNA interference study of Atg5 JOURNAL Osteoarthritis Cartilage 30 (3), 481-493 (2022) PUBMED 34958937 REMARK GeneRIF: Involvement of autophagy in the maintenance of rat intervertebral disc homeostasis: an in-vitro and in-vivo RNA interference study of Atg5. REFERENCE 3 (bases 1 to 2256) AUTHORS Cheng H, Xu B, Zhang L, Wang Y, Chen M and Chen S. TITLE Bortezomib alleviates antibody-mediated rejection in kidney transplantation by facilitating Atg5 expression JOURNAL J Cell Mol Med 25 (23), 10939-10949 (2021) PUBMED 34734681 REMARK GeneRIF: Bortezomib alleviates antibody-mediated rejection in kidney transplantation by facilitating Atg5 expression. REFERENCE 4 (bases 1 to 2256) AUTHORS Osoro EK, Du X, Liang D, Lan X, Farooq R, Huang F, Zhu W, Ren J, Sadiq M, Tian L, Yang X, Li D and Lu S. TITLE Induction of PDCD4 by albumin in proximal tubule epithelial cells potentiates proteinuria-induced dysfunctional autophagy by negatively targeting Atg5 JOURNAL Biochem Cell Biol 99 (5), 617-628 (2021) PUBMED 33831322 REMARK GeneRIF: Induction of PDCD4 by albumin in proximal tubule epithelial cells potentiates proteinuria-induced dysfunctional autophagy by negatively targeting Atg5. REFERENCE 5 (bases 1 to 2256) AUTHORS Zhang C, Zhang C, Wang H, Qi Y, Kan Y and Ge Z. TITLE Effects of miR-103a-3p on the autophagy and apoptosis of cardiomyocytes by regulating Atg5 JOURNAL Int J Mol Med 43 (5), 1951-1960 (2019) PUBMED 30864677 REMARK GeneRIF: following the inhibition of miR103a3p, Atg5 promotes autophagy and apoptosis in cardiomyocytes by directly targeting Atg5. REFERENCE 6 (bases 1 to 2256) AUTHORS Liu CL, Chen S, Dietrich D and Hu BR. TITLE Changes in autophagy after traumatic brain injury JOURNAL J Cereb Blood Flow Metab 28 (4), 674-683 (2008) PUBMED 18059433 REFERENCE 7 (bases 1 to 2256) AUTHORS Nakai A, Yamaguchi O, Takeda T, Higuchi Y, Hikoso S, Taniike M, Omiya S, Mizote I, Matsumura Y, Asahi M, Nishida K, Hori M, Mizushima N and Otsu K. TITLE The role of autophagy in cardiomyocytes in the basal state and in response to hemodynamic stress JOURNAL Nat Med 13 (5), 619-624 (2007) PUBMED 17450150 REFERENCE 8 (bases 1 to 2256) AUTHORS Kochl R, Hu XW, Chan EY and Tooze SA. TITLE Microtubules facilitate autophagosome formation and fusion of autophagosomes with endosomes JOURNAL Traffic 7 (2), 129-145 (2006) PUBMED 16420522 REFERENCE 9 (bases 1 to 2256) AUTHORS Simonsen A, Birkeland HC, Gillooly DJ, Mizushima N, Kuma A, Yoshimori T, Slagsvold T, Brech A and Stenmark H. TITLE Alfy, a novel FYVE-domain-containing protein associated with protein granules and autophagic membranes JOURNAL J Cell Sci 117 (Pt 18), 4239-4251 (2004) PUBMED 15292400 REFERENCE 10 (bases 1 to 2256) AUTHORS Mizushima N, Yamamoto A, Hatano M, Kobayashi Y, Kabeya Y, Suzuki K, Tokuhisa T, Ohsumi Y and Yoshimori T. TITLE Dissection of autophagosome formation using Apg5-deficient mouse embryonic stem cells JOURNAL J Cell Biol 152 (4), 657-668 (2001) PUBMED 11266458 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000330.1. On Dec 29, 2021 this sequence version replaced XM_039098916.1. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: SRR8487227.61877.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMD00132262, SAMD00132264 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-243 JACYVU010000330.1 2958519-2958761 244-408 JACYVU010000330.1 2974096-2974260 409-536 JACYVU010000330.1 2976732-2976859 537-699 JACYVU010000330.1 2989706-2989868 700-794 JACYVU010000330.1 3010402-3010496 795-912 JACYVU010000330.1 3032138-3032255 913-2256 JACYVU010000330.1 3048175-3049518 FEATURES Location/Qualifiers source 1..2256 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="20" /map="20q13" gene 1..2256 /gene="Atg5" /note="autophagy related 5" /db_xref="GeneID:365601" /db_xref="RGD:1359580" exon 1..243 /gene="Atg5" /inference="alignment:Splign:2.1.0" exon 244..408 /gene="Atg5" /inference="alignment:Splign:2.1.0" exon 409..536 /gene="Atg5" /inference="alignment:Splign:2.1.0" misc_feature 516..518 /gene="Atg5" /note="upstream in-frame stop codon" CDS 534..1049 /gene="Atg5" /note="isoform 2 is encoded by transcript variant 2; autophagy protein 5; ATG5 autophagy related 5 homolog" /codon_start=1 /product="autophagy protein 5 isoform 2" /protein_id="NP_001385948.1" /db_xref="GeneID:365601" /db_xref="RGD:1359580" /translation="
MSFPEKDLLHCPCKDAVEAHFMSCVKEADALKHKSQVINEMQRKDHKQLWMGLQNDRFDQFWTINRKLMEYPPEENGFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLREVCPSAVAPEDGEKKSQVMIHGIEPLLETPLQWLSEHLSYPDNFLHISIVPQPTD"
misc_feature 537..1031 /gene="Atg5" /note="Autophagy protein Apg5; Region: APG5; pfam04106" /db_xref="CDD:427714" exon 537..699 /gene="Atg5" /inference="alignment:Splign:2.1.0" exon 700..794 /gene="Atg5" /inference="alignment:Splign:2.1.0" exon 795..912 /gene="Atg5" /inference="alignment:Splign:2.1.0" exon 913..2256 /gene="Atg5" /inference="alignment:Splign:2.1.0" ORIGIN
atctccgggcgccgagggtgactggacttacggtgggctacgggcgctgcggttcgctctggttcggagggcggaagtgcccgctgggctgttttctgacccccggcggcggcgctctgtgcggctgcgcgcgcactgggacttctgctcctgcgcctctgcaggacgctgtgatcccggtagacccaacccgaccgagcgtcttccgcgctgcgggaagccggagcagagccggcacctcggtttggcttggttgaagaaagcacttagcctatatgtactgctctgtccactggaagaatgacagatgacaaagatgtgcttcgagacgtgtggtttggacggattccaacgtgctttactctctatcaggatgagataactgaacgagaagcagagccatactatttgcttttgccaagagtcagctatttgacgctggtaactgacaaagtgaaaaagcactttcagaaggttatgagacaagaagatgttagtgagatttggtttgaatatgaaggcacacccctgaaatgagttttccagaaaaggaccttctgcactgtccgtgcaaggatgcagttgaggctcactttatgtcatgtgtgaaggaagctgacgctttaaagcacaaaagtcaggtgatcaacgaaatgcagagaaaagaccacaagcagctctggatgggactgcagaatgacagatttgaccagttttggaccatcaaccggaaactcatggaataccctccagaagaaaatggatttcgttatatcccttttagaatatatcagaccacaactgaacggcctttcattcagaagctgttccgtcctgtggccgcagatggacagctgcatacccttggagatctcctaagagaagtctgtccttccgcagtcgcccctgaagacggagagaagaagagccaggtgatgattcacgggatcgagcccttgctggaaaccccgctgcagtggctgagcgagcatctgagctatccagacaacttccttcacatcagcattgtgccccagccaacagactgaaggccgtgtcctgctcactggatggaaccacccgcagtcaggacaccgaagcatgacacccttgcttcccgtcaggctcagtggaggcaacagaaccccgggctgctgcaagccaaggcggcagaagattccatgggagatagggcaccggcagggctgagtgtgctccaccgctgcgtcagtaaacctcgctgacaggcaggaccacgcagcctctcttctcgggaactgcagtgcgcacgcttttgctcagtgaaaacattggaaatgtgccagttcgtgtctgattaacaaatcagggggtgtttcctaaggtgacggtggtcggaccttcggctggagagtggaaacactggttgaattttcaatagaattagacttaagaaagtaaaagagaaattctgttattaataacttgcagtaatttttttgtaaaagatcaaattacagtaaacccgtctttccttaatgagaatttcctgtttacagtcagtctattggtatgcaaacaatcttgtaactttgataatgaacagtgagagatttttaaataaagcctctaactacgtttgtcatttaataacatacagtctgtcacttttcagggacctcctgaatctcacacagtaagcctctttctactctgtttccagtgctcactggtgtagcaagggtgcagggcataggggaactcgtctcaggagctctcacaggattcattactgtgacttgaaaatctgtcttctagatactaaagtatcaataatactctgtctctgctgtcctgttggccgctgtacacctgtcaaatcatagtatgccaagtatctgtctacagaaactcagtatttcgaagctccggttccttcccagtgtctgattttcctttttcctttttggctcctggattactgtgtcactgtggcccctggcagccagtctttaaagcctgaaggtggcctgtctctagactgcagtagcttttccttatcattaccaaaaaaacatccagaagtgactggaactcctgccacagtaagggaagttcgctgcactctcccgatggctgcttggagactcctgccattgactgtgagctagcttgctgtccatattgaatgtcaacccacctgagtatgctaaaagatgatatcataaaataatggttttagatttaaaaataaaggtgaatgttttcttataaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]