LOCUS       NM_001191873            1158 bp    mRNA    linear   ROD 21-MAR-2023
DEFINITION  Rattus norvegicus goosecoid homeobox (Gsc), mRNA.
ACCESSION   NM_001191873 XM_343101
VERSION     NM_001191873.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1158)
  AUTHORS   Parry DA, Logan CV, Stegmann AP, Abdelhamed ZA, Calder A, Khan S,
            Bonthron DT, Clowes V, Sheridan E, Ghali N, Chudley AE, Dobbie A,
            Stumpel CT and Johnson CA.
  TITLE     SAMS, a syndrome of short stature, auditory-canal atresia,
            mandibular hypoplasia, and skeletal abnormalities is a unique
            neurocristopathy caused by mutations in Goosecoid
  JOURNAL   Am J Hum Genet 93 (6), 1135-1142 (2013)
   PUBMED   24290375
  REMARK    Review article
REFERENCE   2  (bases 1 to 1158)
  AUTHORS   Pereira LA, Wong MS, Lim SM, Sides A, Stanley EG and Elefanty AG.
  TITLE     Brachyury and related Tbx proteins interact with the Mixl1
            homeodomain protein and negatively regulate Mixl1 transcriptional
            activity
  JOURNAL   PLoS One 6 (12), e28394 (2011)
   PUBMED   22164283
REFERENCE   3  (bases 1 to 1158)
  AUTHORS   Lee D, Park C, Lee H, Lugus JJ, Kim SH, Arentson E, Chung YS, Gomez
            G, Kyba M, Lin S, Janknecht R, Lim DS and Choi K.
  TITLE     ER71 acts downstream of BMP, Notch, and Wnt signaling in blood and
            vessel progenitor specification
  JOURNAL   Cell Stem Cell 2 (5), 497-507 (2008)
   PUBMED   18462699
REFERENCE   4  (bases 1 to 1158)
  AUTHORS   Izzi L, Silvestri C, von Both I, Labbe E, Zakin L, Wrana JL and
            Attisano L.
  TITLE     Foxh1 recruits Gsc to negatively regulate Mixl1 expression during
            early mouse development
  JOURNAL   EMBO J 26 (13), 3132-3143 (2007)
   PUBMED   17568773
REFERENCE   5  (bases 1 to 1158)
  AUTHORS   Lewis SL, Khoo PL, Andrea De Young R, Bildsoe H, Wakamiya M,
            Behringer RR, Mukhopadhyay M, Westphal H and Tam PP.
  TITLE     Genetic interaction of Gsc and Dkk1 in head morphogenesis of the
            mouse
  JOURNAL   Mech Dev 124 (2), 157-165 (2007)
   PUBMED   17127040
REFERENCE   6  (bases 1 to 1158)
  AUTHORS   Borges AC, Marques S and Belo JA.
  TITLE     Goosecoid and cerberus-like do not interact during mouse
            embryogenesis
  JOURNAL   Int J Dev Biol 46 (2), 259-262 (2002)
   PUBMED   11934155
REFERENCE   7  (bases 1 to 1158)
  AUTHORS   Danilov V, Blum M, Schweickert A, Campione M and Steinbeisser H.
  TITLE     Negative autoregulation of the organizer-specific homeobox gene
            goosecoid
  JOURNAL   J Biol Chem 273 (1), 627-635 (1998)
   PUBMED   9417125
REFERENCE   8  (bases 1 to 1158)
  AUTHORS   Filosa S, Rivera-Perez JA, Gomez AP, Gansmuller A, Sasaki H,
            Behringer RR and Ang SL.
  TITLE     Goosecoid and HNF-3beta genetically interact to regulate neural
            tube patterning during mouse embryogenesis
  JOURNAL   Development 124 (14), 2843-2854 (1997)
   PUBMED   9226455
REFERENCE   9  (bases 1 to 1158)
  AUTHORS   Rivera-Perez JA, Mallo M, Gendron-Maguire M, Gridley T and
            Behringer RR.
  TITLE     Goosecoid is not an essential component of the mouse gastrula
            organizer but is required for craniofacial and rib development
  JOURNAL   Development 121 (9), 3005-3012 (1995)
   PUBMED   7555726
REFERENCE   10 (bases 1 to 1158)
  AUTHORS   Yamada G, Mansouri A, Torres M, Stuart ET, Blum M, Schultz M, De
            Robertis EM and Gruss P.
  TITLE     Targeted mutation of the murine goosecoid gene results in
            craniofacial defects and neonatal death
  JOURNAL   Development 121 (9), 2917-2922 (1995)
   PUBMED   7555718
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from
            JACYVU010000168.1.
            
            On Jul 17, 2010 this sequence version replaced XM_343101.4.
            
            Summary: The protein encoded by this gene is likely a homeobox
            transcription factor. [provided by RefSeq, Jul 2008].
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMD00132297,
                              SAMD00132308 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-467               JACYVU010000168.1  2742376-2742842     c
            468-727             JACYVU010000168.1  2741595-2741854     c
            728-1158            JACYVU010000168.1  2740803-2741233     c
FEATURES             Location/Qualifiers
     source          1..1158
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="6"
                     /map="6q32"
     gene            1..1158
                     /gene="Gsc"
                     /note="goosecoid homeobox"
                     /db_xref="GeneID:317715"
                     /db_xref="RGD:631425"
     exon            1..467
                     /gene="Gsc"
                     /inference="alignment:Splign:2.1.0"
     CDS             113..883
                     /gene="Gsc"
                     /note="homeobox protein goosecoid-like"
                     /codon_start=1
                     /product="homeobox protein goosecoid"
                     /protein_id="NP_001178802.1"
                     /db_xref="GeneID:317715"
                     /db_xref="RGD:631425"
                     /translation="

MPASMFSIDNILAARPRCKDAVLPVAPSAAAPVVFPALHGDSLYGAGGGTSSDYGAFYPRPVAPGGAGLPAAVGGSRLGYNSYFYGQLHVQAAPVGPACCGAVPPLGAQQCSCVPTPPGYEGPGSVLVSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSKASPEKREEEGKSDLDSDS"

     misc_feature    order(593..607,611..613,662..664,680..682,719..721,
                     725..730,737..742,746..754,758..763)
                     /gene="Gsc"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    599..760
                     /gene="Gsc"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(599..601,608..610,728..730,737..742,749..751)
                     /gene="Gsc"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            468..727
                     /gene="Gsc"
                     /inference="alignment:Splign:2.1.0"
     exon            728..1158
                     /gene="Gsc"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

cgcgggagcacagagtgggacaacccccaacccccaccccaaacaacaccacttggagacttcttcttcggcgcgtccccgccgccccccggtcccggcgcggggctcggggatgcccgccagcatgttcagcatcgacaacatcctggccgcccggccgcgctgcaaagacgcggtgctcccggtggcgcccagcgccgcggctccggtggtctttccggctctgcacggggactcgctctacggcgctggcggcggcacctcctcggactacggcgccttctacccgcgtcctgtggcccctggaggcgcgggcctcccggccgcggtcggcggctcccgcctgggctacaacagctacttctacgggcagctgcacgtgcaggcggcgcccgtgggcccggcctgctgcggggctgtgccgccgctgggcgcccagcagtgttcctgcgtcccgacgcccccaggctacgagggccccggttctgtactggtgtctccagtgccgcaccagatgctgccctatatgaacgtgggcacgctgtcgcgcactgagctgcagctgctcaaccagctgcactgtcgacggaagcggcggcaccgcaccatcttcaccgacgagcagctcgaagccctggagaacctcttccaggagacaaagtacccagacgtgggcactcgggagcaactggcccggaaggtgcacctccgggaggagaaggtggaggtctggtttaagaaccgccgagccaaatggagacgacagaagagatcctcctcagaggagtcggaaaacgctgagaagtggaacaagacgtcctcgaaagcctcaccagagaagagggaagaggaaggtaaaagcgatttggactcggacagctgacggccgcgggccggccggggcgcttgcctgacgcaaggacttgcacagacagtcgatgctacttgcacacgccctgccttgcgggagggggtcgaagaagcaacgaggagctagctgtaaataatgtaaaggtccgggactgccagggacaggcgcgtggggaccgcagccccgcgtcccgggctgcctgcgtgagccgcgttccccaccgtagtatttatagttaagttaacggtgacagtacaataaagtgatggcgatgcagaccagccatg

//