2024-04-26 13:11:19, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001191873 1158 bp mRNA linear ROD 21-MAR-2023 DEFINITION Rattus norvegicus goosecoid homeobox (Gsc), mRNA. ACCESSION NM_001191873 XM_343101 VERSION NM_001191873.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1158) AUTHORS Parry DA, Logan CV, Stegmann AP, Abdelhamed ZA, Calder A, Khan S, Bonthron DT, Clowes V, Sheridan E, Ghali N, Chudley AE, Dobbie A, Stumpel CT and Johnson CA. TITLE SAMS, a syndrome of short stature, auditory-canal atresia, mandibular hypoplasia, and skeletal abnormalities is a unique neurocristopathy caused by mutations in Goosecoid JOURNAL Am J Hum Genet 93 (6), 1135-1142 (2013) PUBMED 24290375 REMARK Review article REFERENCE 2 (bases 1 to 1158) AUTHORS Pereira LA, Wong MS, Lim SM, Sides A, Stanley EG and Elefanty AG. TITLE Brachyury and related Tbx proteins interact with the Mixl1 homeodomain protein and negatively regulate Mixl1 transcriptional activity JOURNAL PLoS One 6 (12), e28394 (2011) PUBMED 22164283 REFERENCE 3 (bases 1 to 1158) AUTHORS Lee D, Park C, Lee H, Lugus JJ, Kim SH, Arentson E, Chung YS, Gomez G, Kyba M, Lin S, Janknecht R, Lim DS and Choi K. TITLE ER71 acts downstream of BMP, Notch, and Wnt signaling in blood and vessel progenitor specification JOURNAL Cell Stem Cell 2 (5), 497-507 (2008) PUBMED 18462699 REFERENCE 4 (bases 1 to 1158) AUTHORS Izzi L, Silvestri C, von Both I, Labbe E, Zakin L, Wrana JL and Attisano L. TITLE Foxh1 recruits Gsc to negatively regulate Mixl1 expression during early mouse development JOURNAL EMBO J 26 (13), 3132-3143 (2007) PUBMED 17568773 REFERENCE 5 (bases 1 to 1158) AUTHORS Lewis SL, Khoo PL, Andrea De Young R, Bildsoe H, Wakamiya M, Behringer RR, Mukhopadhyay M, Westphal H and Tam PP. TITLE Genetic interaction of Gsc and Dkk1 in head morphogenesis of the mouse JOURNAL Mech Dev 124 (2), 157-165 (2007) PUBMED 17127040 REFERENCE 6 (bases 1 to 1158) AUTHORS Borges AC, Marques S and Belo JA. TITLE Goosecoid and cerberus-like do not interact during mouse embryogenesis JOURNAL Int J Dev Biol 46 (2), 259-262 (2002) PUBMED 11934155 REFERENCE 7 (bases 1 to 1158) AUTHORS Danilov V, Blum M, Schweickert A, Campione M and Steinbeisser H. TITLE Negative autoregulation of the organizer-specific homeobox gene goosecoid JOURNAL J Biol Chem 273 (1), 627-635 (1998) PUBMED 9417125 REFERENCE 8 (bases 1 to 1158) AUTHORS Filosa S, Rivera-Perez JA, Gomez AP, Gansmuller A, Sasaki H, Behringer RR and Ang SL. TITLE Goosecoid and HNF-3beta genetically interact to regulate neural tube patterning during mouse embryogenesis JOURNAL Development 124 (14), 2843-2854 (1997) PUBMED 9226455 REFERENCE 9 (bases 1 to 1158) AUTHORS Rivera-Perez JA, Mallo M, Gendron-Maguire M, Gridley T and Behringer RR. TITLE Goosecoid is not an essential component of the mouse gastrula organizer but is required for craniofacial and rib development JOURNAL Development 121 (9), 3005-3012 (1995) PUBMED 7555726 REFERENCE 10 (bases 1 to 1158) AUTHORS Yamada G, Mansouri A, Torres M, Stuart ET, Blum M, Schultz M, De Robertis EM and Gruss P. TITLE Targeted mutation of the murine goosecoid gene results in craniofacial defects and neonatal death JOURNAL Development 121 (9), 2917-2922 (1995) PUBMED 7555718 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from JACYVU010000168.1. On Jul 17, 2010 this sequence version replaced XM_343101.4. Summary: The protein encoded by this gene is likely a homeobox transcription factor. [provided by RefSeq, Jul 2008]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns SAMD00132297, SAMD00132308 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-467 JACYVU010000168.1 2742376-2742842 c 468-727 JACYVU010000168.1 2741595-2741854 c 728-1158 JACYVU010000168.1 2740803-2741233 c FEATURES Location/Qualifiers source 1..1158 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="6" /map="6q32" gene 1..1158 /gene="Gsc" /note="goosecoid homeobox" /db_xref="GeneID:317715" /db_xref="RGD:631425" exon 1..467 /gene="Gsc" /inference="alignment:Splign:2.1.0" CDS 113..883 /gene="Gsc" /note="homeobox protein goosecoid-like" /codon_start=1 /product="homeobox protein goosecoid" /protein_id="NP_001178802.1" /db_xref="GeneID:317715" /db_xref="RGD:631425" /translation="
MPASMFSIDNILAARPRCKDAVLPVAPSAAAPVVFPALHGDSLYGAGGGTSSDYGAFYPRPVAPGGAGLPAAVGGSRLGYNSYFYGQLHVQAAPVGPACCGAVPPLGAQQCSCVPTPPGYEGPGSVLVSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSKASPEKREEEGKSDLDSDS"
misc_feature order(593..607,611..613,662..664,680..682,719..721, 725..730,737..742,746..754,758..763) /gene="Gsc" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 599..760 /gene="Gsc" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(599..601,608..610,728..730,737..742,749..751) /gene="Gsc" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 468..727 /gene="Gsc" /inference="alignment:Splign:2.1.0" exon 728..1158 /gene="Gsc" /inference="alignment:Splign:2.1.0" ORIGIN
cgcgggagcacagagtgggacaacccccaacccccaccccaaacaacaccacttggagacttcttcttcggcgcgtccccgccgccccccggtcccggcgcggggctcggggatgcccgccagcatgttcagcatcgacaacatcctggccgcccggccgcgctgcaaagacgcggtgctcccggtggcgcccagcgccgcggctccggtggtctttccggctctgcacggggactcgctctacggcgctggcggcggcacctcctcggactacggcgccttctacccgcgtcctgtggcccctggaggcgcgggcctcccggccgcggtcggcggctcccgcctgggctacaacagctacttctacgggcagctgcacgtgcaggcggcgcccgtgggcccggcctgctgcggggctgtgccgccgctgggcgcccagcagtgttcctgcgtcccgacgcccccaggctacgagggccccggttctgtactggtgtctccagtgccgcaccagatgctgccctatatgaacgtgggcacgctgtcgcgcactgagctgcagctgctcaaccagctgcactgtcgacggaagcggcggcaccgcaccatcttcaccgacgagcagctcgaagccctggagaacctcttccaggagacaaagtacccagacgtgggcactcgggagcaactggcccggaaggtgcacctccgggaggagaaggtggaggtctggtttaagaaccgccgagccaaatggagacgacagaagagatcctcctcagaggagtcggaaaacgctgagaagtggaacaagacgtcctcgaaagcctcaccagagaagagggaagaggaaggtaaaagcgatttggactcggacagctgacggccgcgggccggccggggcgcttgcctgacgcaaggacttgcacagacagtcgatgctacttgcacacgccctgccttgcgggagggggtcgaagaagcaacgaggagctagctgtaaataatgtaaaggtccgggactgccagggacaggcgcgtggggaccgcagccccgcgtcccgggctgcctgcgtgagccgcgttccccaccgtagtatttatagttaagttaacggtgacagtacaataaagtgatggcgatgcagaccagccatg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]