GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-08 10:05:53, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001191087             876 bp    mRNA    linear   ROD 22-MAR-2023
DEFINITION  Rattus norvegicus homeobox A6 (Hoxa6), mRNA.
ACCESSION   NM_001191087 XM_001065038
VERSION     NM_001191087.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 876)
  AUTHORS   Deng J, Ding HH, Long JL, Lin SY, Liu M, Zhang XQ, Xin WJ and Ruan
            X.
  TITLE     Oxaliplatin-induced neuropathic pain involves HOXA6 via a
            TET1-dependent demethylation of the SOX10 promoter
  JOURNAL   Int J Cancer 147 (9), 2503-2514 (2020)
   PUBMED   32428246
  REMARK    GeneRIF: Oxaliplatin-induced neuropathic pain involves HOXA6 via a
            TET1-dependent demethylation of the SOX10 promoter.
            Erratum:[Int J Cancer. 2021 Sep 15;149(6):E10. PMID: 34196406]
REFERENCE   2  (bases 1 to 876)
  AUTHORS   McIntyre DC, Rakshit S, Yallowitz AR, Loken L, Jeannotte L,
            Capecchi MR and Wellik DM.
  TITLE     Hox patterning of the vertebrate rib cage
  JOURNAL   Development 134 (16), 2981-2989 (2007)
   PUBMED   17626057
REFERENCE   3  (bases 1 to 876)
  AUTHORS   Polyak K, Lee MH, Erdjument-Bromage H, Koff A, Roberts JM, Tempst P
            and Massague J.
  TITLE     Cloning of p27Kip1, a cyclin-dependent kinase inhibitor and a
            potential mediator of extracellular antimitogenic signals
  JOURNAL   Cell 78 (1), 59-66 (1994)
   PUBMED   8033212
REFERENCE   4  (bases 1 to 876)
  AUTHORS   Kostic D and Capecchi MR.
  TITLE     Targeted disruptions of the murine Hoxa-4 and Hoxa-6 genes result
            in homeotic transformations of components of the vertebral column
  JOURNAL   Mech Dev 46 (3), 231-247 (1994)
   PUBMED   7918106
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from
            JACYVU010000142.1.
            
            On Jul 17, 2010 this sequence version replaced XM_001065038.2.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMEA5760384,
                              SAMEA5760386 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on expression, longest protein
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-540               JACYVU010000142.1  4541711-4542250     c
            541-876             JACYVU010000142.1  4539807-4540142     c
FEATURES             Location/Qualifiers
     source          1..876
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="4"
                     /map="4q24"
     gene            1..876
                     /gene="Hoxa6"
                     /note="homeobox A6"
                     /db_xref="GeneID:685732"
                     /db_xref="RGD:1590236"
     exon            1..540
                     /gene="Hoxa6"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    30..32
                     /gene="Hoxa6"
                     /note="upstream in-frame stop codon"
     CDS             99..800
                     /gene="Hoxa6"
                     /note="homeobox protein Hox-A6-like"
                     /codon_start=1
                     /product="homeobox protein Hox-A6"
                     /protein_id="NP_001178016.1"
                     /db_xref="GeneID:685732"
                     /db_xref="RGD:1590236"
                     /translation="
MSSYFVNPTFPGSLPSGQDSFLGQLPLYPAGYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGNSKQRGPGDYLHFSPEQQYKPDSSSVQGKALHEEGTDRKYTSPVYPWMQRMNSCAGAVYGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQASGEDSEAKAGE"
     misc_feature    order(564..578,582..584,633..635,651..653,690..692,
                     696..701,708..713,717..725,729..734)
                     /gene="Hoxa6"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(570..572,579..581,699..701,708..713,720..722)
                     /gene="Hoxa6"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    573..731
                     /gene="Hoxa6"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     exon            541..876
                     /gene="Hoxa6"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ttcggccatccagaaacaaaccagttcgatgactactaatagttatagccagatgtactaatacacaacaaatcacagtcctgcagaggggcgcgcaaatgagttcctattttgtgaatcccactttccctgggagcctgcccagcggccaggactccttcttgggccagctgcccctctacccggccggctatgacgcgctgaggcccttcccggcctcttatggggcgtcgagtcttccggacaagacatacacctcaccttgtttctaccaacagtccaactcggtcctggcctgcaaccgggcatcctacgagtacggggcctcatgtttctattctgataaggacctcagtggcgcctcaccctcgggcaatagcaagcagaggggccccggggactacctgcacttttctcccgagcagcagtacaaacctgacagcagcagcgtgcagggcaaagccctccatgaggaaggcaccgaccggaagtacacaagccctgtttacccctggatgcagcggatgaattcctgtgcgggtgctgtgtatgggagtcacgggcgcagaggccgccagacctacacgcgctaccagaccctggagctggagaaggaattccacttcaaccgctacctgactcggcggcgccgcatcgagatcgccaacgcgctctgcctcaccgagcgccagatcaagatctggttccagaatcggcgcatgaagtggaaaaaggaaaataaactcatcaattccacgcaggccagcggggaagactctgaggccaaggcgggcgagtagactccaggcagggaccaggccatcgttgtaacctctattggctttgccccctggtgcccttgcctgctccccaagt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]