2024-04-20 14:06:46, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001108644 881 bp mRNA linear ROD 21-AUG-2023 DEFINITION Rattus norvegicus microfibril associated protein 5 (Mfap5), mRNA. ACCESSION NM_001108644 XM_001060323 XM_342750 VERSION NM_001108644.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 881) AUTHORS Hofling C, Rossner S, Flachmeyer B, Krueger M, Hartig W and Michalski D. TITLE Tricellulin, alpha-Catenin and Microfibrillar-Associated Protein 5 Exhibit Concomitantly Altered Immunosignals along with Vascular, Extracellular and Cytoskeletal Elements after Experimental Focal Cerebral Ischemia JOURNAL Int J Mol Sci 24 (15), 11893 (2023) PUBMED 37569268 REMARK GeneRIF: Tricellulin, alpha-Catenin and Microfibrillar-Associated Protein 5 Exhibit Concomitantly Altered Immunosignals along with Vascular, Extracellular and Cytoskeletal Elements after Experimental Focal Cerebral Ischemia. Publication Status: Online-Only REFERENCE 2 (bases 1 to 881) AUTHORS Barallobre-Barreiro J, Oklu R, Lynch M, Fava M, Baig F, Yin X, Barwari T, Potier DN, Albadawi H, Jahangiri M, Porter KE, Watkins MT, Misra S, Stoughton J and Mayr M. TITLE Extracellular matrix remodelling in response to venous hypertension: proteomics of human varicose veins JOURNAL Cardiovasc Res 110 (3), 419-430 (2016) PUBMED 27068509 REFERENCE 3 (bases 1 to 881) AUTHORS Abonnenc M, Nabeebaccus AA, Mayr U, Barallobre-Barreiro J, Dong X, Cuello F, Sur S, Drozdov I, Langley SR, Lu R, Stathopoulou K, Didangelos A, Yin X, Zimmermann WH, Shah AM, Zampetaki A and Mayr M. TITLE Extracellular matrix secretion by cardiac fibroblasts: role of microRNA-29b and microRNA-30c JOURNAL Circ Res 113 (10), 1138-1147 (2013) PUBMED 24006456 REFERENCE 4 (bases 1 to 881) AUTHORS Combs MD, Knutsen RH, Broekelmann TJ, Toennies HM, Brett TJ, Miller CA, Kober DL, Craft CS, Atkinson JJ, Shipley JM, Trask BC and Mecham RP. TITLE Microfibril-associated glycoprotein 2 (MAGP2) loss of function has pleiotropic effects in vivo JOURNAL J Biol Chem 288 (40), 28869-28880 (2013) PUBMED 23963447 REFERENCE 5 (bases 1 to 881) AUTHORS Lemaire R, Bayle J, Mecham RP and Lafyatis R. TITLE Microfibril-associated MAGP-2 stimulates elastic fiber assembly JOURNAL J Biol Chem 282 (1), 800-808 (2007) PUBMED 17099216 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CH473964.2. On or before Oct 4, 2007 this sequence version replaced XM_342750.3, XM_001060323.1. ##Evidence-Data-START## CDS exon combination :: FQ229611.1, FM103833.1 [ECO:0000331] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, longest protein ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..881 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="4" /map="4q42" gene 1..881 /gene="Mfap5" /note="microfibril associated protein 5" /db_xref="GeneID:362429" /db_xref="RGD:1307919" exon 1..89 /gene="Mfap5" /inference="alignment:Splign:2.1.0" misc_feature 76..78 /gene="Mfap5" /note="upstream in-frame stop codon" exon 90..145 /gene="Mfap5" /inference="alignment:Splign:2.1.0" exon 146..205 /gene="Mfap5" /inference="alignment:Splign:2.1.0" CDS 148..648 /gene="Mfap5" /note="microfibrillar associated protein 5" /codon_start=1 /product="microfibrillar-associated protein 5 precursor" /protein_id="NP_001102114.1" /db_xref="GeneID:362429" /db_xref="RGD:1307919" /translation="
MLVFGQKALLLVVALSIPSDWLPLGVSGQRGDDVPETFTDDPNLVNDPSTDDTVLADITPSTDDLASAGDKNTTAECRDEKFACTRLYSVHRPVRQCVHQACFTSLRRMYIINNEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENMNLQRPDGP"
sig_peptide 148..195 /gene="Mfap5" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 151..555 /gene="Mfap5" /note="Microfibril-associated glycoprotein (MAGP); Region: MAGP; pfam05507" /db_xref="CDD:428500" exon 206..241 /gene="Mfap5" /inference="alignment:Splign:2.1.0" exon 242..274 /gene="Mfap5" /inference="alignment:Splign:2.1.0" exon 275..307 /gene="Mfap5" /inference="alignment:Splign:2.1.0" exon 308..343 /gene="Mfap5" /inference="alignment:Splign:2.1.0" exon 344..373 /gene="Mfap5" /inference="alignment:Splign:2.1.0" exon 374..461 /gene="Mfap5" /inference="alignment:Splign:2.1.0" exon 462..535 /gene="Mfap5" /inference="alignment:Splign:2.1.0" exon 536..881 /gene="Mfap5" /inference="alignment:Splign:2.1.0" ORIGIN
agatttccaggtgcaagaagacaaggttgccccagagaagcagtcgcatcaaggtgagccagccccctaagtcactaagacagactgcagacagacacactcggcagccagaggccacggcggacagagcacagcgctgtagacaatatgctggtctttgggcagaaggccttgctgcttgtcgtggcactcagcatcccctccgactggctacccctaggggtcagtggccaacgaggagatgacgtacccgagacattcacagatgaccctaatctggtgaatgatccttctacagacgatacagttctggcggatatcacaccttccacggatgacctggcctcagctggtgacaaaaatactactgcagagtgccgggatgagaagtttgcttgtacaagactgtactctgtccatcggcccgtcagacagtgtgtgcaccaggcctgcttcaccagtttacgtcgcatgtacatcatcaataatgagatctgttcccggcttgtctgtaaagaacacgaggccatgaaagatgagctttgccggcagatggcaggcctgcctccaaggcgactccgccgctccaactacttccgacttcctccctgtgaaaatatgaacttacagagacccgatggtccgtgatcaccaaggaagaacgaagaaagtgtggatgagggaatccgaaattccttctactccaaccgctgccatctgtcccgtagacgtgtatttttaaactaagccctttgcaatgtcccggcttcctaccctactctgtaattttcactggaactggtaacgtttgtctcgtttcgcaatacagtgtctccattgttgtacgggctcgctgatatctggtatgggagacaaggtgg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]