LOCUS       NM_001108644             881 bp    mRNA    linear   ROD 21-AUG-2023
DEFINITION  Rattus norvegicus microfibril associated protein 5 (Mfap5), mRNA.
ACCESSION   NM_001108644 XM_001060323 XM_342750
VERSION     NM_001108644.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 881)
  AUTHORS   Hofling C, Rossner S, Flachmeyer B, Krueger M, Hartig W and
            Michalski D.
  TITLE     Tricellulin, alpha-Catenin and Microfibrillar-Associated Protein 5
            Exhibit Concomitantly Altered Immunosignals along with Vascular,
            Extracellular and Cytoskeletal Elements after Experimental Focal
            Cerebral Ischemia
  JOURNAL   Int J Mol Sci 24 (15), 11893 (2023)
   PUBMED   37569268
  REMARK    GeneRIF: Tricellulin, alpha-Catenin and Microfibrillar-Associated
            Protein 5 Exhibit Concomitantly Altered Immunosignals along with
            Vascular, Extracellular and Cytoskeletal Elements after
            Experimental Focal Cerebral Ischemia.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 881)
  AUTHORS   Barallobre-Barreiro J, Oklu R, Lynch M, Fava M, Baig F, Yin X,
            Barwari T, Potier DN, Albadawi H, Jahangiri M, Porter KE, Watkins
            MT, Misra S, Stoughton J and Mayr M.
  TITLE     Extracellular matrix remodelling in response to venous
            hypertension: proteomics of human varicose veins
  JOURNAL   Cardiovasc Res 110 (3), 419-430 (2016)
   PUBMED   27068509
REFERENCE   3  (bases 1 to 881)
  AUTHORS   Abonnenc M, Nabeebaccus AA, Mayr U, Barallobre-Barreiro J, Dong X,
            Cuello F, Sur S, Drozdov I, Langley SR, Lu R, Stathopoulou K,
            Didangelos A, Yin X, Zimmermann WH, Shah AM, Zampetaki A and Mayr
            M.
  TITLE     Extracellular matrix secretion by cardiac fibroblasts: role of
            microRNA-29b and microRNA-30c
  JOURNAL   Circ Res 113 (10), 1138-1147 (2013)
   PUBMED   24006456
REFERENCE   4  (bases 1 to 881)
  AUTHORS   Combs MD, Knutsen RH, Broekelmann TJ, Toennies HM, Brett TJ, Miller
            CA, Kober DL, Craft CS, Atkinson JJ, Shipley JM, Trask BC and
            Mecham RP.
  TITLE     Microfibril-associated glycoprotein 2 (MAGP2) loss of function has
            pleiotropic effects in vivo
  JOURNAL   J Biol Chem 288 (40), 28869-28880 (2013)
   PUBMED   23963447
REFERENCE   5  (bases 1 to 881)
  AUTHORS   Lemaire R, Bayle J, Mecham RP and Lafyatis R.
  TITLE     Microfibril-associated MAGP-2 stimulates elastic fiber assembly
  JOURNAL   J Biol Chem 282 (1), 800-808 (2007)
   PUBMED   17099216
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CH473964.2.
            
            On or before Oct 4, 2007 this sequence version replaced
            XM_342750.3, XM_001060323.1.
            
            ##Evidence-Data-START##
            CDS exon combination :: FQ229611.1, FM103833.1 [ECO:0000331]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, longest protein
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..881
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="4"
                     /map="4q42"
     gene            1..881
                     /gene="Mfap5"
                     /note="microfibril associated protein 5"
                     /db_xref="GeneID:362429"
                     /db_xref="RGD:1307919"
     exon            1..89
                     /gene="Mfap5"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    76..78
                     /gene="Mfap5"
                     /note="upstream in-frame stop codon"
     exon            90..145
                     /gene="Mfap5"
                     /inference="alignment:Splign:2.1.0"
     exon            146..205
                     /gene="Mfap5"
                     /inference="alignment:Splign:2.1.0"
     CDS             148..648
                     /gene="Mfap5"
                     /note="microfibrillar associated protein 5"
                     /codon_start=1
                     /product="microfibrillar-associated protein 5 precursor"
                     /protein_id="NP_001102114.1"
                     /db_xref="GeneID:362429"
                     /db_xref="RGD:1307919"
                     /translation="

MLVFGQKALLLVVALSIPSDWLPLGVSGQRGDDVPETFTDDPNLVNDPSTDDTVLADITPSTDDLASAGDKNTTAECRDEKFACTRLYSVHRPVRQCVHQACFTSLRRMYIINNEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENMNLQRPDGP"

     sig_peptide     148..195
                     /gene="Mfap5"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     misc_feature    151..555
                     /gene="Mfap5"
                     /note="Microfibril-associated glycoprotein (MAGP); Region:
                     MAGP; pfam05507"
                     /db_xref="CDD:428500"
     exon            206..241
                     /gene="Mfap5"
                     /inference="alignment:Splign:2.1.0"
     exon            242..274
                     /gene="Mfap5"
                     /inference="alignment:Splign:2.1.0"
     exon            275..307
                     /gene="Mfap5"
                     /inference="alignment:Splign:2.1.0"
     exon            308..343
                     /gene="Mfap5"
                     /inference="alignment:Splign:2.1.0"
     exon            344..373
                     /gene="Mfap5"
                     /inference="alignment:Splign:2.1.0"
     exon            374..461
                     /gene="Mfap5"
                     /inference="alignment:Splign:2.1.0"
     exon            462..535
                     /gene="Mfap5"
                     /inference="alignment:Splign:2.1.0"
     exon            536..881
                     /gene="Mfap5"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

agatttccaggtgcaagaagacaaggttgccccagagaagcagtcgcatcaaggtgagccagccccctaagtcactaagacagactgcagacagacacactcggcagccagaggccacggcggacagagcacagcgctgtagacaatatgctggtctttgggcagaaggccttgctgcttgtcgtggcactcagcatcccctccgactggctacccctaggggtcagtggccaacgaggagatgacgtacccgagacattcacagatgaccctaatctggtgaatgatccttctacagacgatacagttctggcggatatcacaccttccacggatgacctggcctcagctggtgacaaaaatactactgcagagtgccgggatgagaagtttgcttgtacaagactgtactctgtccatcggcccgtcagacagtgtgtgcaccaggcctgcttcaccagtttacgtcgcatgtacatcatcaataatgagatctgttcccggcttgtctgtaaagaacacgaggccatgaaagatgagctttgccggcagatggcaggcctgcctccaaggcgactccgccgctccaactacttccgacttcctccctgtgaaaatatgaacttacagagacccgatggtccgtgatcaccaaggaagaacgaagaaagtgtggatgagggaatccgaaattccttctactccaaccgctgccatctgtcccgtagacgtgtatttttaaactaagccctttgcaatgtcccggcttcctaccctactctgtaattttcactggaactggtaacgtttgtctcgtttcgcaatacagtgtctccattgttgtacgggctcgctgatatctggtatgggagacaaggtgg

//