GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-06 08:12:47, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001106584             617 bp    mRNA    linear   ROD 22-MAR-2023
DEFINITION  Rattus norvegicus replication protein A3 (Rpa3), mRNA.
ACCESSION   NM_001106584 XM_001054662 XM_216097
VERSION     NM_001106584.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 617)
  AUTHORS   McJunkin K, Mazurek A, Premsrirut PK, Zuber J, Dow LE, Simon J,
            Stillman B and Lowe SW.
  TITLE     Reversible suppression of an essential gene in adult mice using
            transgenic RNA interference
  JOURNAL   Proc Natl Acad Sci U S A 108 (17), 7113-7118 (2011)
   PUBMED   21482754
REFERENCE   2  (bases 1 to 617)
  AUTHORS   Sakaguchi K, Ishibashi T, Uchiyama Y and Iwabata K.
  TITLE     The multi-replication protein A (RPA) system--a new perspective
  JOURNAL   FEBS J 276 (4), 943-963 (2009)
   PUBMED   19154342
  REMARK    Review article
REFERENCE   3  (bases 1 to 617)
  AUTHORS   Salas TR, Petruseva I, Lavrik O and Saintome C.
  TITLE     Evidence for direct contact between the RPA3 subunit of the human
            replication protein A and single-stranded DNA
  JOURNAL   Nucleic Acids Res 37 (1), 38-46 (2009)
   PUBMED   19010961
REFERENCE   4  (bases 1 to 617)
  AUTHORS   Li GM.
  TITLE     Mechanisms and functions of DNA mismatch repair
  JOURNAL   Cell Res 18 (1), 85-98 (2008)
   PUBMED   18157157
  REMARK    Review article
REFERENCE   5  (bases 1 to 617)
  AUTHORS   Sleeth KM, Sorensen CS, Issaeva N, Dziegielewski J, Bartek J and
            Helleday T.
  TITLE     RPA mediates recombination repair during replication stress and is
            displaced from DNA by checkpoint signalling in human cells
  JOURNAL   J Mol Biol 373 (1), 38-47 (2007)
   PUBMED   17765923
REFERENCE   6  (bases 1 to 617)
  AUTHORS   Bochkareva E, Korolev S, Lees-Miller SP and Bochkarev A.
  TITLE     Structure of the RPA trimerization core and its role in the
            multistep DNA-binding mechanism of RPA
  JOURNAL   EMBO J 21 (7), 1855-1863 (2002)
   PUBMED   11927569
REFERENCE   7  (bases 1 to 617)
  AUTHORS   DeMott MS, Zigman S and Bambara RA.
  TITLE     Replication protein A stimulates long patch DNA base excision
            repair
  JOURNAL   J Biol Chem 273 (42), 27492-27498 (1998)
   PUBMED   9765279
REFERENCE   8  (bases 1 to 617)
  AUTHORS   Lin YL, Shivji MK, Chen C, Kolodner R, Wood RD and Dutta A.
  TITLE     The evolutionarily conserved zinc finger motif in the largest
            subunit of human replication protein A is required for DNA
            replication and mismatch repair but not for nucleotide excision
            repair
  JOURNAL   J Biol Chem 273 (3), 1453-1461 (1998)
   PUBMED   9430682
REFERENCE   9  (bases 1 to 617)
  AUTHORS   Lopez-Girona A, Bachs O and Agell N.
  TITLE     Calmodulin is involved in the induction of DNA polymerases alpha
            and delta activities in normal rat kidney cells activated to
            proliferate
  JOURNAL   Biochem Biophys Res Commun 217 (2), 566-574 (1995)
   PUBMED   7503737
REFERENCE   10 (bases 1 to 617)
  AUTHORS   He Z, Henricksen LA, Wold MS and Ingles CJ.
  TITLE     RPA involvement in the damage-recognition and incision steps of
            nucleotide excision repair
  JOURNAL   Nature 374 (6522), 566-569 (1995)
   PUBMED   7700386
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CH473959.1.
            
            On or before Oct 4, 2007 this sequence version replaced
            XM_216097.4, XM_001054662.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: FQ228706.1, BG661076.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           SAMD00132293, SAMD00132303
                                           [ECO:0000350]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..617
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="4"
                     /map="4q21"
     gene            1..617
                     /gene="Rpa3"
                     /note="replication protein A3"
                     /db_xref="GeneID:296883"
                     /db_xref="RGD:1306810"
     exon            1..130
                     /gene="Rpa3"
                     /inference="alignment:Splign:2.1.0"
     CDS             32..397
                     /gene="Rpa3"
                     /codon_start=1
                     /product="replication protein A 14 kDa subunit"
                     /protein_id="NP_001100054.1"
                     /db_xref="GeneID:296883"
                     /db_xref="RGD:1306810"
                     /translation="
MVDIMELPKARVNASMLSQYIERPVCFVGKLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGKVTAKATILCASYILFKEDCNRFDLELYNEAVKIINEFPQFFPLGLTQHE"
     misc_feature    44..370
                     /gene="Rpa3"
                     /note="Replication factor A protein 3; Region:
                     Rep_fac-A_3; pfam08661"
                     /db_xref="CDD:400821"
     misc_feature    order(53..58,62..64,233..235,293..295,311..316,332..334,
                     341..343,347..349,353..358,365..370)
                     /gene="Rpa3"
                     /note="trimerization core interface [active]"
                     /db_xref="CDD:239925"
     misc_feature    order(53..58,62..64,233..235,293..295,311..316,347..349,
                     356..358,365..370)
                     /gene="Rpa3"
                     /note="RPA3/RPA2 DBD-D interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239925"
     misc_feature    order(122..130,149..160,164..166,185..193,197..199,
                     224..226,245..253,263..271)
                     /gene="Rpa3"
                     /note="generic binding surface I [active]"
                     /db_xref="CDD:239925"
     misc_feature    order(314..316,332..334,353..355)
                     /gene="Rpa3"
                     /note="RPA3/RPA1 DBD-C interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239925"
     exon            131..205
                     /gene="Rpa3"
                     /inference="alignment:Splign:2.1.0"
     exon            206..314
                     /gene="Rpa3"
                     /inference="alignment:Splign:2.1.0"
     exon            315..617
                     /gene="Rpa3"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
cctgcgggttgtgagttttggcggcagaatcatggtggacataatggaactccccaaagcgcgcgtcaacgccagcatgttatcacagtatatcgaacgacccgtgtgcttcgtggggaagctggaaaagattcatcccactggaaaaatgtttattctttcagatggagaaggaaagaatggaaccattgaattgatggagccactggatgaagaaatctctggaatcgtagaagtagtcgggaaggtgacagccaaggcaaccatactatgtgcatcttatatcctgtttaaggaagattgtaatcgctttgatcttgaactttacaatgaagctgtgaaaattatcaatgagtttcctcagttttttcctttagggcttacacaacatgaatgagcttcttgaatttcttaagattgccagtaagctacattgaaagttattaaagaagactccttcagtttaagggagagactcctataatttctaatatttaatttgcttttttatatatattttttgtaaatctactatgacagtttacatctaagtctttttataaattttttaaaatcgatacttcaatatatggtctgaataaaaagaaaattaaaat
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]