GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-26 13:25:42, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001105746            2231 bp    mRNA    linear   ROD 21-MAR-2023
DEFINITION  Rattus norvegicus POU class 6 homeobox 1 (Pou6f1), mRNA.
ACCESSION   NM_001105746 XM_001064836 XM_343334
VERSION     NM_001105746.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 2231)
  AUTHORS   Li WY, Li ZG, Fu XM, Wang XY, Lv ZX, Sun P, Zhu XF and Wang Y.
  TITLE     Transgenic Schwann cells overexpressing POU6F1 promote sciatic
            nerve regeneration within acellular nerve allografts
  JOURNAL   J Neural Eng 19 (6) (2022)
   PUBMED   36317259
  REMARK    GeneRIF: Transgenic Schwann cells overexpressing POU6F1 promote
            sciatic nerve regeneration within acellular nerve allografts.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 2231)
  AUTHORS   Toda K, Yamamoto D, Fumoto M, Ikeshita N, Herningtyas EH, Iida K,
            Takahashi Y, Kaji H, Chihara K and Okimura Y.
  TITLE     Involvement of mPOU (Brn-5), a class VI POU protein, in the gene
            expression of Pit-1 as well as PRL
  JOURNAL   Mol Cell Endocrinol 280 (1-2), 20-29 (2008)
   PUBMED   17933456
  REMARK    GeneRIF: Brn-5 enhances prolactin gene expression directly in
            association with Pit-1 and CREB-binding protein, and indirectly via
            the activation of Pit-1 gene expression.
REFERENCE   3  (bases 1 to 2231)
  AUTHORS   Molinari S, Relaix F, Lemonnier M, Kirschbaum B, Schafer B and
            Buckingham M.
  TITLE     A novel complex regulates cardiac actin gene expression through
            interaction of Emb, a class VI POU domain protein, MEF2D, and the
            histone transacetylase p300
  JOURNAL   Mol Cell Biol 24 (7), 2944-2957 (2004)
   PUBMED   15024082
REFERENCE   4  (bases 1 to 2231)
  AUTHORS   Cui H and Bulleit RF.
  TITLE     Expression of the POU transcription factor Brn-5 is an early event
            in the terminal differentiation of CNS neurons
  JOURNAL   J Neurosci Res 52 (6), 625-632 (1998)
   PUBMED   9669311
REFERENCE   5  (bases 1 to 2231)
  AUTHORS   Wey E and Schafer BW.
  TITLE     Identification of novel DNA binding sites recognized by the
            transcription factor mPOU (POU6F1)
  JOURNAL   Biochem Biophys Res Commun 220 (2), 274-279 (1996)
   PUBMED   8645295
REFERENCE   6  (bases 1 to 2231)
  AUTHORS   Wey E, Lyons GE and Schafer BW.
  TITLE     A human POU domain gene, mPOU, is expressed in developing brain and
            specific adult tissues
  JOURNAL   Eur J Biochem 220 (3), 753-762 (1994)
   PUBMED   7908264
REFERENCE   7  (bases 1 to 2231)
  AUTHORS   Andersen B, Schonemann MD, Pearse RV 2nd, Jenne K, Sugarman J and
            Rosenfeld MG.
  TITLE     Brn-5 is a divergent POU domain factor highly expressed in layer IV
            of the neocortex
  JOURNAL   J Biol Chem 268 (31), 23390-23398 (1993)
   PUBMED   7901208
REFERENCE   8  (bases 1 to 2231)
  AUTHORS   Okamoto K, Wakamiya M, Noji S, Koyama E, Taniguchi S, Takemura R,
            Copeland NG, Gilbert DJ, Jenkins NA, Muramatsu M et al.
  TITLE     A novel class of murine POU gene predominantly expressed in central
            nervous system
  JOURNAL   J Biol Chem 268 (10), 7449-7457 (1993)
   PUBMED   8463278
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            CH474035.2.
            
            On or before Oct 3, 2007 this sequence version replaced
            XM_343334.3, XM_001064836.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: L23204.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00132265, SAMD00132285
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..2231
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="7"
                     /map="7q36"
     gene            1..2231
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /note="POU class 6 homeobox 1"
                     /db_xref="GeneID:116545"
                     /db_xref="RGD:620615"
     exon            1..845
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    690..692
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /note="upstream in-frame stop codon"
     CDS             801..1706
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /note="brain-5; brn-5 protein; brain-specific homeobox/POU
                     domain protein 5"
                     /codon_start=1
                     /product="POU domain, class 6, transcription factor 1"
                     /protein_id="NP_001099216.1"
                     /db_xref="GeneID:116545"
                     /db_xref="RGD:620615"
                     /translation="
MPGISSPILTNAQGQVIGALPWVVNSASVATPAPAQSLQVQAVTPQLLLNAQGQVIATLASSPLPQPVAVRKPSTPESPAKSEVQPIQPTQAVPPPAVILTSPAPALKPSASAPIPITCSETPTVSQLVSKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIP"
     misc_feature    831..968
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /note="propagated from UniProtKB/Swiss-Prot (P56223.1);
                     Region: 2 X 7 AA repeats of N-A-Q-G-Q-V-I"
     misc_feature    <867..1265
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /note="DNA polymerase III subunits gamma and tau;
                     Provisional; Region: PRK14950"
                     /db_xref="CDD:237864"
     misc_feature    996..1064
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /note="propagated from UniProtKB/Swiss-Prot (P56223.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    1215..1439
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /note="Pou domain - N-terminal to homeobox domain; Region:
                     Pou; cl22952"
                     /db_xref="CDD:451464"
     misc_feature    order(1503..1517,1521..1523,1572..1574,1590..1592,
                     1629..1631,1635..1640,1647..1652,1656..1664,1668..1673)
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    1509..1670
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(1509..1511,1518..1520,1638..1640,1647..1652,
                     1659..1661)
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            846..1049
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /inference="alignment:Splign:2.1.0"
     exon            1050..1191
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /inference="alignment:Splign:2.1.0"
     exon            1192..1360
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /inference="alignment:Splign:2.1.0"
     exon            1361..2231
                     /gene="Pou6f1"
                     /gene_synonym="Brn5"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
cggaaagatttctgcagcagtgctccccttccctgtgactgtgctccccttccctgtgactgtgctcccctcccctatgactatgctcttcctcccctgtgactgtgctccccttccccaagactgtgctccctttctttcaactgtatttcccctcctgtgactgtgctccccttcccagagactgtgctctcctgtgactgtgctcctcttctctgagactgtgctcccttcccccaagactatgttccccttcccagagactgtgttcccctcccctatcactgtgttcccctcccctgttactgtgctcccttcccctgtgactctgctctcctcccctgtgactgtgctccccttccccatgactgtgctccccttccccgtgactgtgctccccttccccatgactgtgctccccttccccgtgactgtgctcccctcccccgtcactatgctctcctcccccgtgactgtgctccccttccccgtgactgtgctccccttccccgtgactgtgctccccttccccgtgactgtgctccccttccccgtgactgtgctccccttccctgctatccccctgtacttgtctccctagtcttgagtaccagccagtggactagagcctgcagcccagtaccctcagccctcttccctctctgtgccctttcttgcctctcggtctctgagcaaggctcttcctccacccacagatcagtgccgcgtcccttgggggacagacgcaaatcctgggctccctcactacagctccagttattaccaacaccattcccagcatgcccgggatcagcagtccgatcctcaccaatgctcagggacaggttattggagcacttccatgggtagtgaactcagccagtgtggccacaccagcaccagcacagagcctgcaggtccaagctgtgactccccagctcttgttgaatgcccagggccaggtgatcgcaacactagccagcagccccctgcctcaacctgtggctgtccggaagccaagcacaccggagtcccctgcaaagagtgaggtgcaacccatccagccgacacaagccgtgcccccacctgctgtaatcctcaccagcccagctccagcactcaagccatcagcctcagctcccatcccaatcacctgctcagagacacctacagtcagtcagttggtatcaaaaccgcacactccgagtctggatgaggacgggatcaacttagaagagatccgggagtttgccaagaattttaagatccggaggctctccctgggtctgacacagacccaggtgggccaggctctgaccgcaacagaggggccagcctacagccaatcagccatctgcaggttcgagaagttagacatcacacccaagagtgcccagaagctgaagccggttttggaaaagtggttgaacgaggcagagctccggaaccaggaaggccagcagaatctgatggagtttgtgggcggcgagccctccaagaaacgcaagcggcgtacttccttcacaccacaggccatagaggctctcaatgcctactttgagaaaaaccccctgcccaccggccaggagatcaccgagatcgctaaggagctcaactatgaccgtgaggtggtgagggtctggttctgtaatcgacgccagacactcaagaacaccagcaagctgaatgtctttcagatcccctagggctcggggtcagcgtgttccttgtgcgaatccctcagcagtcagctgaagtcactgagtggcagtactgtgggcagctgtgcttgccctcggtcatgagactccacctgtgcatgtgtgtcaatgcctgcctcttctgcccacatatgtcacaccctggggaggcccgaggggctgcatgagagccctaggctctgggctgggcatgtggaaggagggggttggtggggtccttagaaaagcactttgccgaggtggtttctgaagggtgaattctggttgagaaccaggaaggctctgtctttggggcagggccgtagcaactcttggggacaactgtgtagtggctcttggttttggtgacgtcctttcccccttcccctcactcctctgtggctgtgccggtgtgacaacacaccgggtggaactgcagcctcacactgcctcccttcctctgaatatgggcacactgaaccccctgaaaggactgaggaatccagagagtcgtggtgtgctgctcagacc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]