2024-04-25 19:34:24, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001017480 1235 bp mRNA linear ROD 21-MAR-2023 DEFINITION Rattus norvegicus homeo box B7 (Hoxb7), mRNA. ACCESSION NM_001017480 XM_573181 VERSION NM_001017480.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1235) AUTHORS Li H, Shen LY, Yan WP, Dong B, Kang XZ, Dai L, Yang YB, Fu H, Yang HL, Zhou HT, Huang C, Liang Z, Xiong HC and Chen KN. TITLE Deregulated HOXB7 Expression Predicts Poor Prognosis of Patients with Esophageal Squamous Cell Carcinoma and Regulates Cancer Cell Proliferation In Vitro and In Vivo JOURNAL PLoS One 10 (6), e0130551 (2015) PUBMED 26076456 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1235) AUTHORS Yuan W, Zhang X, Xu Y, Li S, Hu Y and Wu S. TITLE Role of HOXB7 in regulation of progression and metastasis of human lung adenocarcinoma JOURNAL Mol Carcinog 53 (1), 49-57 (2014) PUBMED 22911672 REFERENCE 3 (bases 1 to 1235) AUTHORS Murawski IJ, Myburgh DB, Favor J and Gupta IR. TITLE Vesico-ureteric reflux and urinary tract development in the Pax2 1Neu+/- mouse JOURNAL Am J Physiol Renal Physiol 293 (5), F1736-F1745 (2007) PUBMED 17881463 REFERENCE 4 (bases 1 to 1235) AUTHORS Wu X, Chen H, Parker B, Rubin E, Zhu T, Lee JS, Argani P and Sukumar S. TITLE HOXB7, a homeodomain protein, is overexpressed in breast cancer and confers epithelial-mesenchymal transition JOURNAL Cancer Res 66 (19), 9527-9534 (2006) PUBMED 17018609 REMARK Erratum:[Cancer Res. 2015 Jun 1;75(11):2401. PMID: 26032426] REFERENCE 5 (bases 1 to 1235) AUTHORS Medina-Martinez O, Bradley A and Ramirez-Solis R. TITLE A large targeted deletion of Hoxb1-Hoxb9 produces a series of single-segment anterior homeotic transformations JOURNAL Dev Biol 222 (1), 71-83 (2000) PUBMED 10885747 REFERENCE 6 (bases 1 to 1235) AUTHORS Care A, Silvani A, Meccia E, Mattia G, Stoppacciaro A, Parmiani G, Peschle C and Colombo MP. TITLE HOXB7 constitutively activates basic fibroblast growth factor in melanomas JOURNAL Mol Cell Biol 16 (9), 4842-4851 (1996) PUBMED 8756643 REFERENCE 7 (bases 1 to 1235) AUTHORS Chung SY, Dai PH, Lei J, Riviere M, Levan G, Szpirer J and Szpirer C. TITLE Chromosomal assignment of seven rat homeobox genes to rat chromosomes 3, 4, 7, and 10 JOURNAL Mamm Genome 4 (9), 537-540 (1993) PUBMED 7906969 REFERENCE 8 (bases 1 to 1235) AUTHORS de Jong R, de Laaf L, Vennema H and Meijlink F. TITLE DNA-binding activity of the murine homeodomain protein Hox-2.3 produced by a hybrid phage T7/vaccinia virus system JOURNAL Gene 116 (2), 195-203 (1992) PUBMED 1353046 REFERENCE 9 (bases 1 to 1235) AUTHORS Wu J, Zhu JQ, Zhu DX, Scharfman A, Lamblin G and Han KK. TITLE Selective inhibition of normal murine myelopoiesis 'in vitro' by a Hox 2.3 antisense oligodeoxynucleotide JOURNAL Cell Mol Biol 38 (4), 367-376 (1992) PUBMED 1354076 REFERENCE 10 (bases 1 to 1235) AUTHORS Falzon M and Chung SY. TITLE The expression of rat homeobox-containing genes is developmentally regulated and tissue specific JOURNAL Development 103 (3), 601-610 (1988) PUBMED 2907739 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC079340.1. On Apr 29, 2005 this sequence version replaced XM_573181.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC079340.1, CK480314.1 [ECO:0000332] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1235 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="10" /map="10q26" gene 1..1235 /gene="Hoxb7" /gene_synonym="Hox2r1b; R1b" /note="homeo box B7" /db_xref="GeneID:497985" /db_xref="RGD:1559918" exon 1..419 /gene="Hoxb7" /gene_synonym="Hox2r1b; R1b" /inference="alignment:Splign:2.1.0" CDS 20..679 /gene="Hoxb7" /gene_synonym="Hox2r1b; R1b" /note="homeobox gene B7; homeobox protein R1B" /codon_start=1 /product="homeobox protein Hox-B7" /protein_id="NP_001017480.1" /db_xref="GeneID:497985" /db_xref="RGD:1559918" /translation="
MSSLYYANALFSKYPAASSVFAPGAFPEQTSCAFASNPQRPGYGAGPGAPFSASVQGLYSGGGGMAGQSAAGVYEAGYGLEPSSFNMHCAPFEQNLSGVCPGDPAKAAGAKEQRDSDLAAESNFRIYPWMRSSGTERKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTSGPGTTGQDKAEADEEEEEEE"
misc_feature 395..412 /gene="Hoxb7" /gene_synonym="Hox2r1b; R1b" /note="propagated from UniProtKB/Swiss-Prot (P18864.2); Region: Antp-type hexapeptide" misc_feature order(431..445,449..451,500..502,518..520,557..559, 563..568,575..580,584..592,596..601) /gene="Hoxb7" /gene_synonym="Hox2r1b; R1b" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(437..439,446..448,566..568,575..580,587..589) /gene="Hoxb7" /gene_synonym="Hox2r1b; R1b" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 440..598 /gene="Hoxb7" /gene_synonym="Hox2r1b; R1b" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature 596..676 /gene="Hoxb7" /gene_synonym="Hox2r1b; R1b" /note="propagated from UniProtKB/Swiss-Prot (P18864.2); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" exon 420..1213 /gene="Hoxb7" /gene_synonym="Hox2r1b; R1b" /inference="alignment:Splign:2.1.0" ORIGIN
caaatcatccggccaaattatgagttcattgtattatgcgaatgctttattttctaaatatccagccgcaagttcggttttcgctccaggagccttccccgaacaaacttcttgcgcctttgcctccaacccccagcgcccgggctatggagcaggtccgggcgcccccttctccgcctcggtgcagggtctgtactccggcggtgggggcatggcgggccagagcgcggccggcgtctatgaggccggctacgggctcgaaccgagttccttcaacatgcactgcgcgccctttgagcagaacctctccggggtgtgtccgggcgaccccgccaaggcggctggcgccaaggagcagagggactcggacttggcggccgagagtaacttccggatctacccctggatgcgaagctcagggactgaacgaaagcggggccgccagacctatacgcgctaccagaccctggagctggagaaagaatttcactacaatcgctacctgactcggcggcggcgcatcgagatcgcgcacgcgctctgcctcaccgaaagacagatcaagatctggtttcagaaccggcgcatgaagtggaaaaaggagaacaaaacttcaggcccaggaaccactggccaggacaaggcggaagcggacgaggaggaagaggaggaagagtgagagacagagaaagggaagagaggaggaaagagaagagagggagaacccaattgtgggaactgaagcacggaactcaaataagggggcaaactgtttaagtgaagaagtctgaaattttaaggaaagagatgggtgaaatttgggtttcttactactgtaaaaaaaaatactacctatgggaaagtgtgtggtctgtttttgtacagtctgggaaggacattatctacctgctctgtggctttttggaatgtgcctccccttttctatgttgcgagtaaggtctttgtaacatcttgctgttttgtaagccctctttgaagctgtctttgtgaattgtggttccagatgagccgattaacctgtggctcctcacctaccatatacttcccagtagtactaagagggtcttagggagccccgaggatccactagcttctgagcctggtgcatttggctgctgattctagctcctaaccatgagcctctttctgtatatctgaaggatggaaaaaataaaaaaggattaaataccaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]