2024-04-29 15:08:55, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001004224 1231 bp mRNA linear ROD 22-MAR-2023 DEFINITION Rattus norvegicus B-cell receptor-associated protein 31 (Bcap31), mRNA. ACCESSION NM_001004224 XM_215226 VERSION NM_001004224.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1231) AUTHORS Li Y, Jain N, Limpanawat S, To J, Quistgaard EM, Nordlund P, Thanabalu T and Torres J. TITLE Interaction between human BAP31 and respiratory syncytial virus small hydrophobic (SH) protein JOURNAL Virology 482, 105-110 (2015) PUBMED 25854864 REFERENCE 2 (bases 1 to 1231) AUTHORS Zhang C, Kho YS, Wang Z, Chiang YT, Ng GK, Shaw PC, Wang Y and Qi RZ. TITLE Transmembrane and coiled-coil domain family 1 is a novel protein of the endoplasmic reticulum JOURNAL PLoS One 9 (1), e85206 (2014) PUBMED 24454821 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1231) AUTHORS Cacciagli P, Sutera-Sardo J, Borges-Correia A, Roux JC, Dorboz I, Desvignes JP, Badens C, Delepine M, Lathrop M, Cau P, Levy N, Girard N, Sarda P, Boespflug-Tanguy O and Villard L. TITLE Mutations in BCAP31 cause a severe X-linked phenotype with deafness, dystonia, and central hypomyelination and disorganize the Golgi apparatus JOURNAL Am J Hum Genet 93 (3), 579-586 (2013) PUBMED 24011989 REFERENCE 4 (bases 1 to 1231) AUTHORS Iwasawa R, Mahul-Mellier AL, Datler C, Pazarentzos E and Grimm S. TITLE Fis1 and Bap31 bridge the mitochondria-ER interface to establish a platform for apoptosis induction JOURNAL EMBO J 30 (3), 556-568 (2011) PUBMED 21183955 REFERENCE 5 (bases 1 to 1231) AUTHORS Ghosh D, Lippert D, Krokhin O, Cortens JP and Wilkins JA. TITLE Defining the membrane proteome of NK cells JOURNAL J Mass Spectrom 45 (1), 1-25 (2010) PUBMED 19946888 REFERENCE 6 (bases 1 to 1231) AUTHORS Pang AL, Taylor HC, Johnson W, Alexander S, Chen Y, Su YA, Li X, Ravindranath N, Dym M, Rennert OM and Chan WY. TITLE Identification of differentially expressed genes in mouse spermatogenesis JOURNAL J Androl 24 (6), 899-911 (2003) PUBMED 14581517 REFERENCE 7 (bases 1 to 1231) AUTHORS Bell AW, Ward MA, Blackstock WP, Freeman HN, Choudhary JS, Lewis AP, Chotai D, Fazel A, Gushue JN, Paiement J, Palcy S, Chevet E, Lafreniere-Roula M, Solari R, Thomas DY, Rowley A and Bergeron JJ. TITLE Proteomics characterization of abundant Golgi membrane proteins JOURNAL J Biol Chem 276 (7), 5152-5165 (2001) PUBMED 11042173 REFERENCE 8 (bases 1 to 1231) AUTHORS Annaert WG, Becker B, Kistner U, Reth M and Jahn R. TITLE Export of cellubrevin from the endoplasmic reticulum is controlled by BAP31 JOURNAL J Cell Biol 139 (6), 1397-1410 (1997) PUBMED 9396746 REFERENCE 9 (bases 1 to 1231) AUTHORS Li E, Bestagno M and Burrone O. TITLE Molecular cloning and characterization of a transmembrane surface antigen in human cells JOURNAL Eur J Biochem 238 (3), 631-638 (1996) PUBMED 8706661 REFERENCE 10 (bases 1 to 1231) AUTHORS Adachi T, Schamel WW, Kim KM, Watanabe T, Becker B, Nielsen PJ and Reth M. TITLE The specificity of association of the IgD molecule with the accessory proteins BAP31/BAP29 lies in the IgD transmembrane sequence JOURNAL EMBO J 15 (7), 1534-1541 (1996) PUBMED 8612576 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC079182.1. On Sep 10, 2004 this sequence version replaced XM_215226.2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC079182.1, FQ219790.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN16676811 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1231 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="X" /map="Xq37" gene 1..1231 /gene="Bcap31" /gene_synonym="Bap31" /note="B-cell receptor-associated protein 31" /db_xref="GeneID:293852" /db_xref="RGD:1302944" exon 1..44 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" exon 45..180 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" CDS 89..826 /gene="Bcap31" /gene_synonym="Bap31" /codon_start=1 /product="B-cell receptor-associated protein 31" /protein_id="NP_001004224.1" /db_xref="GeneID:293852" /db_xref="RGD:1302944" /translation="
MSLQWTAVATFLYAEVFAVLLLCIPFISPKRWQKIFKSRLVELVVTYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGTAEDGGKLDVGSPEMKLEENKILKTDLKKLKDELASTKKKLEKAENEALAMQKQSEGLTKEYDRLLEEHAKLQASVRGPSDKKEE"
misc_feature 89..496 /gene="Bcap31" /gene_synonym="Bap31" /note="B-cell receptor-associated protein 31-like; Region: Bap31; pfam05529" /db_xref="CDD:428511" misc_feature 662..823 /gene="Bcap31" /gene_synonym="Bap31" /note="Bap31/Bap29 cytoplasmic coiled-coil domain; Region: Bap31_Bap29_C; pfam18035" /db_xref="CDD:436226" exon 181..281 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" exon 282..429 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" exon 430..565 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" exon 566..686 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" exon 687..787 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" exon 788..1205 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" ORIGIN
gagtttggtagttgcagtggggcgtgcgcgtaggctgaaactcggaaacaagctcctatccatctgttggaaacctttaagtcacaggatgagtctgcagtggactgcagttgccaccttcctctacgcagaggtctttgctgtgttgcttctctgcattcccttcatttctcccaaaagatggcagaagatttttaaatctcggctggttgagttggtagtgacctatggcaacactttctttgtggttctcatcgtcatccttgtgctgttggtcattgatgctgtacgtgagatccggaaatatgatgatgtaacagaaaaggtgaacctccagaacaatccaggtgccatggagcacttccacatgaagcttttccgtgctcagaggaatctctatattgctggcttttccttgctgctgtccttcctgcttagacgcctggtgactctcatctcccagcaggccacactgctggcctccaatgaagcctttaaaaagcaggcagaaagtgccagtgaggcagccaagaaatacatggaggagaatgatcagctaaagaagggaactgctgaggatggaggcaagttggatgttgggagtcctgaaatgaagttagaggagaacaagatcctgaagactgatctgaagaagctaaaagatgagctggccagcaccaagaaaaaacttgagaaagctgaaaacgaggctctggctatgcagaagcagtctgagggccttaccaaagaatatgaccgtctgctagaagagcacgccaagctgcaggcctcagtacgtggtccctcagacaagaaggaggagtaaagacttggtttttccctgcctgtagctggcttatacttgacccatgcttactgcttccttggagcccagcctgtccctctggtacttggtttattcccttccatttccccaattttcttccatggcttatagatcattttggccccattacacatactactcttataccaaaaaggacctgattgttgttcattcacagtaattttgccactgttctgcctggccagggcactttccactcctagaagtgtagaaaagcactggtgacctgggctgcacttgtactccattttattttgccatgtatcctaaaagaggctgctgttaagcaggtcaactgttttatcctgaggggaataaatgttgttatgttacaaggaaaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]