2025-09-18 02:43:21, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS XM_036160034 1357 bp mRNA linear ROD 07-FEB-2024 DEFINITION PREDICTED: Mus musculus claudin 14 (Cldn14), transcript variant X2, mRNA. ACCESSION XM_036160034 VERSION XM_036160034.1 DBLINK BioProject: PRJNA169 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_000082.7) annotated using gene prediction method: Gnomon, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_000001635.27-RS_2024_02 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/01/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1357 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6J" /db_xref="taxon:10090" /chromosome="16" gene 1..1357 /gene="Cldn14" /note="claudin 14; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 5 ESTs, 2 long SRA reads, 11 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns" /db_xref="GeneID:56173" /db_xref="MGI:MGI:1860425" CDS 432..1151 /gene="Cldn14" /codon_start=1 /product="claudin-14 isoform X1" /protein_id="XP_036015927.1" /db_xref="GeneID:56173" /db_xref="MGI:MGI:1860425" /translation="
MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEAPYRPYPPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV"
misc_feature 498..974 /gene="Cldn14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN
ctgagcgagacactggcccctttttaaaaaggacagagtcggaatggcatgttctgaaagggcagcgttgatagctgaaactaggtgcgcctcaggccggggctgtgggaagcccgagcatcttgggcaccagcaaagtttctagcagccttgggaaggagaggaaagtcaggtggatctgattggtgggaaaggtgacctggggaaacttgccctgtggttcatacaacctgccaggcagaagcaggagccaggggcacctgagcaagaaaccccataagatgttcaagtggagttccagacaggcacctggatatagttctggacccggagggggacgcgtcaacactgcttcctgcgggcacctaaggaccagatccatccctggggacctgggcactgctcagcgcggctagcaggggcccttagccatggccagcacagcggtccagctcctaggcttcctgcttagcttcctgggcatggtaggaacgctcatcaccaccatcctgccacactggcggaggacggcccatgtgggcaccaacatcctgactgccgtatcctacctgaagggactgtggatggaatgtgtgtggcacagcacaggcatctaccagtgtcagatctaccgctcactgctggcgctgccccgggacttgcaggccgcccgggcgctcatggtcatctcctgcctgttgtcgggcatggcctgcgcctgcgcagtagtgggcatgaagtgcacacgctgcgccaaaggcacacccgccaagaccacctttgcagtgctggggggcgcgctcttcctgctggccggcctgctgtgcatggtggccgtgtcctggaccacgaatgacgtggtgcagaatttttataacccgctgctgcccagtggcatgaagtttgaaatcggccaggccctgtacctgggcttcatctcctcatccctgtctctcatcgggggcaccctgctctgcttatcctgccaggacgaggccccctacagaccctacccgccccagtccagggccggagctaccaccacggctaccgcccctgcctaccgcccaccagcggcctacaaggacaaccgtgccccctcggtgacctcagccgcgcacagtgggtacaggctgaatgactacgtgtgagttccttccccgggcttctgccagggatgctgggccccaaaggaccaatgatggatgtgggaaggatgcagagagcaagcccggaacacagggaaggaggtgctcttcaaagcaaagacttctaaaaagtgctggttttttatttattatatgtatttatgcgggtggcttaataagagctcaataaagagtgtcttggaagcgtg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]