GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-06-29 12:12:36, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_205822                735 bp    mRNA    linear   ROD 13-AUG-2022
DEFINITION  Mus musculus oocyte maturation, beta (Omt2b), mRNA.
ACCESSION   NM_205822 XM_356169
VERSION     NM_205822.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 735)
  AUTHORS   Gindi N, Grossman H, Bar-Joseph H, Miller I, Nemerovsky L, Hadas R,
            Nevo N, Galiani D, Dekel N and Shalgi R.
  TITLE     Fyn and argonaute 2 participate in maternal-mRNA degradation during
            mouse oocyte maturation
  JOURNAL   Cell Cycle 21 (8), 792-804 (2022)
   PUBMED   35104175
REFERENCE   2  (bases 1 to 735)
  AUTHORS   Popova NV and Morris RJ.
  TITLE     Genetic regulation of mouse stem cells: identification of two
            keratinocyte stem cell regulatory loci
  JOURNAL   Curr Top Microbiol Immunol 280, 111-137 (2004)
   PUBMED   14594209
REFERENCE   3  (bases 1 to 735)
  AUTHORS   Popova NV, Teti KA, Wu KQ and Morris RJ.
  TITLE     Identification of two keratinocyte stem cell regulatory loci
            implicated in skin carcinogenesis
  JOURNAL   Carcinogenesis 24 (3), 417-425 (2003)
   PUBMED   12663500
REFERENCE   4  (bases 1 to 735)
  AUTHORS   West MF, Verrotti AC, Salles FJ, Tsirka SE and Strickland S.
  TITLE     Isolation and characterization of two novel, cytoplasmically
            polyadenylated, oocyte-specific, mouse maternal RNAs
  JOURNAL   Dev Biol 175 (1), 132-141 (1996)
   PUBMED   8608859
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC138587.11, CO795725.1 and AU022354.1.
            
            On Apr 13, 2007 this sequence version replaced NM_205822.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AU022354.1, BG071097.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849374, SAMN00849383
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-235               AC138587.11        111530-111764
            236-711             CO795725.1         127-602
            712-735             AU022354.1         1-24                c
FEATURES             Location/Qualifiers
     source          1..735
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="9"
                     /map="9 43.65 cM"
     gene            1..735
                     /gene="Omt2b"
                     /gene_synonym="Mosg; OM2b"
                     /note="oocyte maturation, beta"
                     /db_xref="GeneID:382088"
                     /db_xref="MGI:MGI:106619"
     exon            1..235
                     /gene="Omt2b"
                     /gene_synonym="Mosg; OM2b"
                     /inference="alignment:Splign:2.1.0"
     CDS             109..468
                     /gene="Omt2b"
                     /gene_synonym="Mosg; OM2b"
                     /codon_start=1
                     /product="oocyte maturation, beta"
                     /protein_id="NP_991391.2"
                     /db_xref="CCDS:CCDS52869.1"
                     /db_xref="GeneID:382088"
                     /db_xref="MGI:MGI:106619"
                     /translation="
MMSQLHICYGPVCEMQHHLPSFLDPLEFVIVYLETWVYKGLFDLRPELLLYFLNMHVLITSDGDLSETVLYIYGSKGIRIFAMFVIVSLACNLRTKRNRARAWARGLQSPVWWNRRYFI"
     exon            236..406
                     /gene="Omt2b"
                     /gene_synonym="Mosg; OM2b"
                     /inference="alignment:Splign:2.1.0"
     exon            407..735
                     /gene="Omt2b"
                     /gene_synonym="Mosg; OM2b"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
agtgtgccttgggggtggggcttgggggtggagagacaggaaagcagacagaaggcagcatttagaagaaggtgtagccaatctgaagatcttttgcagggaagggtgatgatgtctcaacttcacatatgttatggccctgtttgtgagatgcaacatcaccttccatctttcctggaccccctggagtttgtgattgtgtacctagagacctgggtctacaaaggattgtttgatttgaggccggaactattgctatactttttgaatatgcacgttcttattacatctgatggtgatttaagtgaaacagtcctgtacatttatggatccaaagggattaggatctttgcaatgtttgtgattgtgtcgctagcttgcaatctccggaccaagcgaaatcgagccagagcctgggccagaggcctgcaaagccctgtgtggtggaaccggaggtacttcatttaagaggacgcctgtccaggacccgttgttcagatgtcctttgccataatgttaaccttggaacagccttgcctgtggagaagccggcttgaccatgatgccaagttccagatctttttgtgccaggacaggtggggagggggttttaccagtgttcttaactatactgtgatttttattattgccatgtccagcttttaagtggggttttaacggttttataataaataaaagtttcaggcagaagaaaggaccatgtgtttgacttac
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]