ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-05-09 12:29:42, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_201638 2625 bp mRNA linear ROD 18-NOV-2025
DEFINITION Mus musculus methyltransferase 14, N6-adenosine-methyltransferase
subunit (Mettl14), mRNA.
ACCESSION NM_201638 XM_131193
VERSION NM_201638.2
KEYWORDS RefSeq; RefSeq Select.
SOURCE Mus musculus (house mouse)
ORGANISM Mus musculus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE 1 (bases 1 to 2625)
AUTHORS Huang,C., Wang,X., Gu,Y., Ren,K., Zang,H., Zhang,Y., Pan,Y.,
Cheng,S., Zhu,X., Wu,S., Duan,L., Xu,X., Ye,Q., Zeng,J., Hu,H. and
Gao,S.
TITLE METTL14 Enhances Antitumor Immunity through m6A-Dependent Loss of
PD-1
JOURNAL Cancer Res 85 (21), 4151-4163 (2025)
PUBMED 40865050
REFERENCE 2 (bases 1 to 2625)
AUTHORS Wu,M., Wu,X., Sun,H., Wang,W., Zhang,L., Liu,X., Zhang,Y.,
Zhang,X., Liu,J., Shen,B. and Zhou,T.
TITLE VIRMA-mediated m6A modification regulates forebrain formation
through modulating ribosome biogenesis
JOURNAL Sci Adv 11 (26), eadq9643 (2025)
PUBMED 40577453
REFERENCE 3 (bases 1 to 2625)
AUTHORS Huang,F., Wang,Y., Zhang,X., Gao,W., Li,J., Yang,Y., Mo,H.,
Prince,E., Long,Y., Hu,J., Jiang,C., Kang,Y., Chen,Z., Hu,Y.C.,
Zeng,C., Yang,L., Chen,C.W., Chen,J., Huang,H. and Weng,H.
TITLE m6A/IGF2BP3-driven serine biosynthesis fuels AML stemness and
metabolic vulnerability
JOURNAL Nat Commun 16 (1), 4214 (2025)
PUBMED 40328743
REMARK Publication Status: Online-Only
REFERENCE 4 (bases 1 to 2625)
AUTHORS Yen,Y.P., Lung,T.H., Liau,E.S., Wu,C.C., Huang,G.L., Hsu,F.Y.,
Chang,M., Yang,Z.D., Huang,C.Y., Zheng,Z., Zhao,W., Hung,J.H.,
He,C., Nie,Q. and Chen,J.A.
TITLE The motor neuron m6A repertoire governs neuronal homeostasis and
FTO inhibition mitigates ALS symptom manifestation
JOURNAL Nat Commun 16 (1), 4063 (2025)
PUBMED 40307231
REMARK Publication Status: Online-Only
REFERENCE 5 (bases 1 to 2625)
AUTHORS Katoku-Kikyo,N., Kawakami,H., Cantor,M., Kawakami,Y. and Kikyo,N.
TITLE METTL14 regulates chondrogenesis through the
GDF5-RUNX-extracellular matrix gene axis during limb development
JOURNAL Nat Commun 16 (1), 4072 (2025)
PUBMED 40307229
REMARK Publication Status: Online-Only
REFERENCE 6 (bases 1 to 2625)
AUTHORS Wang,Y., Li,Y., Toth,J.I., Petroski,M.D., Zhang,Z. and Zhao,J.C.
TITLE N6-methyladenosine modification destabilizes developmental
regulators in embryonic stem cells
JOURNAL Nat Cell Biol 16 (2), 191-198 (2014)
PUBMED 24394384
REFERENCE 7 (bases 1 to 2625)
AUTHORS Okazaki,N., Kikuno,R., Ohara,R., Inamoto,S., Koseki,H., Hiraoka,S.,
Saga,Y., Nagase,T., Ohara,O. and Koga,H.
TITLE Prediction of the coding sequences of mouse homologues of KIAA
gene: III. the complete nucleotide sequences of 500 mouse
KIAA-homologous cDNAs identified by screening of terminal sequences
of cDNA clones randomly sampled from size-fractionated libraries
JOURNAL DNA Res 10 (4), 167-180 (2003)
PUBMED 14621295
REFERENCE 8 (bases 1 to 2625)
AUTHORS Mu,X., Zhao,S., Pershad,R., Hsieh,T.F., Scarpa,A., Wang,S.W.,
White,R.A., Beremand,P.D., Thomas,T.L., Gan,L. and Klein,W.H.
TITLE Gene expression in the developing mouse retina by EST sequencing
and microarray analysis
JOURNAL Nucleic Acids Res 29 (24), 4983-4993 (2001)
PUBMED 11812828
REFERENCE 9 (bases 1 to 2625)
AUTHORS Piao,Y., Ko,N.T., Lim,M.K. and Ko,M.S.
TITLE Construction of long-transcript enriched cDNA libraries from
submicrogram amounts of total RNAs by a universal PCR amplification
method
JOURNAL Genome Res 11 (9), 1553-1558 (2001)
PUBMED 11544199
REFERENCE 10 (bases 1 to 2625)
AUTHORS Huttenhofer,A., Kiefmann,M., Meier-Ewert,S., O'Brien,J.,
Lehrach,H., Bachellerie,J.P. and Brosius,J.
TITLE RNomics: an experimental approach that identifies 201 candidates
for novel, small, non-messenger RNAs in mouse
JOURNAL EMBO J 20 (11), 2943-2953 (2001)
PUBMED 11387227
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
BE448358.1, AK146881.1, BI990545.1 and BM247306.2.
On Sep 30, 2009 this sequence version replaced NM_201638.1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AK146881.1, BC052204.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMN01164142 [ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
RefSeq Select criteria :: based on single protein-coding transcript
##RefSeq-Attributes-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-12 BE448358.1 119-130
13-1620 AK146881.1 2-1609
1621-2048 BI990545.1 173-600
2049-2625 BM247306.2 1-577 c
FEATURES Location/Qualifiers
source 1..2625
/organism="Mus musculus"
/mol_type="mRNA"
/db_xref="taxon:10090"
/chromosome="3"
/map="3 53.96 cM"
gene 1..2625
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/note="methyltransferase 14,
N6-adenosine-methyltransferase subunit"
/db_xref="GeneID:210529"
/db_xref="MGI:MGI:2442926"
exon 1..229
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/inference="alignment:Splign:2.1.0"
misc_feature 44..46
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/note="upstream in-frame stop codon"
CDS 164..1534
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/EC_number="2.1.1.62"
/note="methyltransferase-like protein 14; snoRNA MBII-84;
N6-adenosine-methyltransferase subunit METTL14;
N6-adenosine-methyltransferase non-catalytic subunit;
methyltransferase like 14"
/codon_start=1
/product="N(6)-adenosine-methyltransferase non-catalytic
subunit METTL14"
/protein_id="NP_964000.2"
/db_xref="CCDS:CCDS38622.1"
/db_xref="GeneID:210529"
/db_xref="MGI:MGI:2442926"
/translation="
MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNSKRKCLDEGETDEDKVEEYKDELEMQQEEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGGTSAGRGRERNRSNFRGERGGFRGGRGGTHRGGFTPR"
misc_feature 311..388
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/note="propagated from UniProtKB/Swiss-Prot (Q3UIK4.1);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
misc_feature 566..571
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/note="propagated from UniProtKB/Swiss-Prot (Q3UIK4.1);
Region: Interaction with METTL3.
/evidence=ECO:0000250|UniProtKB:Q9HCE5"
misc_feature 599..601
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/note="Interaction with METTL3.
/evidence=ECO:0000250|UniProtKB:Q9HCE5; propagated from
UniProtKB/Swiss-Prot (Q3UIK4.1); other site"
misc_feature 719..1252
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/note="Region: MT-A70; pfam05063"
/db_xref="CDD:368270"
misc_feature 872..877
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/note="propagated from UniProtKB/Swiss-Prot (Q3UIK4.1);
Region: Interaction with METTL3.
/evidence=ECO:0000250|UniProtKB:Q9HCE5"
misc_feature 887..889
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/note="Interaction with METTL3.
/evidence=ECO:0000250|UniProtKB:Q9HCE5; propagated from
UniProtKB/Swiss-Prot (Q3UIK4.1); other site"
misc_feature 896..925
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/note="propagated from UniProtKB/Swiss-Prot (Q3UIK4.1);
Region: Positively charged region required for
RNA-binding. /evidence=ECO:0000250|UniProtKB:Q9HCE5"
misc_feature 896..898
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/note="Interaction with METTL3.
/evidence=ECO:0000250|UniProtKB:Q9HCE5; propagated from
UniProtKB/Swiss-Prot (Q3UIK4.1); other site"
misc_feature 926..937
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/note="propagated from UniProtKB/Swiss-Prot (Q3UIK4.1);
Region: Interaction with METTL3.
/evidence=ECO:0000250|UniProtKB:Q9HCE5"
misc_feature 995..1024
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/note="propagated from UniProtKB/Swiss-Prot (Q3UIK4.1);
Region: Interaction with METTL3.
/evidence=ECO:0000250|UniProtKB:Q9HCE5"
misc_feature 1052..1057
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/note="propagated from UniProtKB/Swiss-Prot (Q3UIK4.1);
Region: Positively charged region required for
RNA-binding. /evidence=ECO:0000250|UniProtKB:Q9HCE5"
misc_feature 1055..1057
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/note="Interaction with METTL3.
/evidence=ECO:0000250|UniProtKB:Q9HCE5; propagated from
UniProtKB/Swiss-Prot (Q3UIK4.1); other site"
misc_feature 1085..1099
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/note="propagated from UniProtKB/Swiss-Prot (Q3UIK4.1);
Region: Interaction with METTL3.
/evidence=ECO:0000250|UniProtKB:Q9HCE5"
misc_feature 1340..1531
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/note="propagated from UniProtKB/Swiss-Prot (Q3UIK4.1);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
misc_feature 1358..1360
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/note="Interaction with METTL3.
/evidence=ECO:0000250|UniProtKB:Q9HCE5; propagated from
UniProtKB/Swiss-Prot (Q3UIK4.1); other site"
misc_feature 1358..1360
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:Q9HCE5; propagated from
UniProtKB/Swiss-Prot (Q3UIK4.1); phosphorylation site"
exon 230..318
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/inference="alignment:Splign:2.1.0"
exon 319..406
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/inference="alignment:Splign:2.1.0"
exon 407..487
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/inference="alignment:Splign:2.1.0"
exon 488..575
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/inference="alignment:Splign:2.1.0"
exon 576..666
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/inference="alignment:Splign:2.1.0"
exon 667..808
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/inference="alignment:Splign:2.1.0"
exon 809..901
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/inference="alignment:Splign:2.1.0"
exon 902..1018
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/inference="alignment:Splign:2.1.0"
exon 1019..1229
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/inference="alignment:Splign:2.1.0"
exon 1230..2625
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/inference="alignment:Splign:2.1.0"
regulatory 2602..2607
/regulatory_class="polyA_signal_sequence"
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/note="hexamer: AATAAA"
polyA_site 2623
/gene="Mettl14"
/gene_synonym="G430022H21Rik; mKIAA1627"
/note="major polyA site"
ORIGIN
atagcctgtttcaggcgcgccggaaacttcctcctgagggacgtgaaagtctccgggtcagaatctctgcggggcgggacccggtgtttcctggtttggcaggtggatttgcattttggcgggcgcggagtctgtcggggtggtgagcagccgaagctggggcatggatagccgcctgcaggagatccgggagcggcagaagttacggcggcagctcctagctcagcagttgggagctgagagtgcggatagcattggtgctgtgttaaatagcaaagatgaacagagggagattgctgaaaccagagaaacctgcagggcttcctatgatacatctgctccaaactcaaaacggaagtgtctggatgaaggagagactgatgaagacaaagtagaagaatataaggatgaactggaaatgcagcaggaggaagagaatttgccatatgaagaagagatttacaaagattccagtacctttcttaagggaacgcagagcttaaatccccataatgattactgccaacattttgtagacactggacacagacctcagaatttcatcagggatgtaggtttagctgacagatttgaagaataccctaaacttagggaactcatcagactaaaggatgagttaatagctaagtcaaacactcctcccatgtacttacaagcagacatagaagcctttgacatcagagaattgacacccaaatttgatgtgattctcctggagccccctctggaagaatactatagagagactggcatcactgcgaatgagaaatgctggacctgggatgatattatgaagttagaaatcgatgagattgcagcacctcggtcatttatatttctctggtgcggttctggggaaggattggaccttgggagagtatgcttgcgaaagtggggttacagaagatgtgaagatatttgttggattaaaaccaataaaaacaatcctggaaagacaaagactctagatccaaaggcagttttccagagaacaaaggagcattgcctgatggggatcaaaggaaccgtgaagcgaagcacagacggggacttcattcatgctaatgttgacattgacttaattatcacagaagaacctgagattggcaatatagaaaaaccagtagaaatttttcatataatagaacatttttgtcttggtagaagacgccttcatctctttgggagagatagcactatcaggccaggctggctcacagttggaccaacgcttacaaacagtaactacaatgcagaaacatatgcatcgtatttcagtgcccccaactcatacttgaccggatgtacagaggaaatcgagaggcttcgaccgaagtcacctcctcccaagtccaagtctgaccgtgggggtggagctcccagaggtggaggaagggggggaacatctgctggccgtggtcgggaaagaaaccgatccaatttccgaggagagagaggtggctttagggggggccgtggaggcacgcacagaggcggctttactcctcggtagctcttacacttgcatctttatcacagtggagacttgcttcagagctcactcccagcttgtactttgctttagtttctcatgctgccagaaagatcttagccaccccaccccaccccagggactggcagttgtcacagactgagcttttgctcagggtgggtgagtcacgtgtgcgcaacaccccgacctgacttgactgattccagtcaaggctttggcttcctggaaatggctgcgcagaggcttcggcatctcagaggagtggcaggagtgggtgctgtgttccctgtcatggctgcacggcagcaggaggctgggaacccgggtagaacagaattagagaggtggtcactgtgttgggcctttaatgttttcttgttgaaacactaaaaagagaagagtttttccccttacttttaaattctaaaaaataacatgaagtatcatttgagttcccagaactcgggaggggaaatgaaatctcgttcttccagatcagaatctgaggtggttgcagtcgtcagggtaggtaacgggagaggcaggcagagcatgggatatttcaaacaaaaccaagcttatcataatgtaaattagcggctacagatggctcctgaccatgtgtcttcagaagcaagacaaggcatgtatgtctccaggtcggagtgtgaacctgatcttgggctaacctaagataattcagatttcttagcaaaggcaaaaacagatttggggaggggctggtttaaacggttgagaaaataaaatcttgatgatgaggaaatgacaaacatctttaaagttgttactaaagaaaatttaggtaaaagcaattccagaaaacccttacgaatacagcgtggaagaggacctgcagtgtcctttgattagaactatgtggtgcagaagtcgccgcagggctgatgggcagatctcttggctgtgggaagcttcgtgctgttgcctttctacaccttaagtcctatttgatggatttggatatgccagatgagataatgccaatattgttctgggtaactccttttttattttgctataacttttctaataaaaatttaaacctttgaatt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]