LOCUS       NM_201236                977 bp    mRNA    linear   ROD 04-AUG-2023
DEFINITION  Mus musculus reproductive homeobox 4E (Rhox4e), mRNA.
ACCESSION   NM_201236 XM_109566
VERSION     NM_201236.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 977)
  AUTHORS   Thompson CL, Ng L, Menon V, Martinez S, Lee CK, Glattfelder K,
            Sunkin SM, Henry A, Lau C, Dang C, Garcia-Lopez R, Martinez-Ferre
            A, Pombero A, Rubenstein JLR, Wakeman WB, Hohmann J, Dee N, Sodt
            AJ, Young R, Smith K, Nguyen TN, Kidney J, Kuan L, Jeromin A,
            Kaykas A, Miller J, Page D, Orta G, Bernard A, Riley Z, Smith S,
            Wohnoutka P, Hawrylycz MJ, Puelles L and Jones AR.
  TITLE     A high-resolution spatiotemporal atlas of gene expression of the
            developing mouse brain
  JOURNAL   Neuron 83 (2), 309-323 (2014)
   PUBMED   24952961
REFERENCE   2  (bases 1 to 977)
  AUTHORS   MacLean,J.A. 2nd, Lorenzetti,D., Hu,Z., Salerno,W.J., Miller,J. and
            Wilkinson,M.F.
  TITLE     Rhox homeobox gene cluster: recent duplication of three family
            members
  JOURNAL   Genesis 44 (3), 122-129 (2006)
   PUBMED   16496311
REFERENCE   3  (bases 1 to 977)
  AUTHORS   Morris L, Gordon J and Blackburn CC.
  TITLE     Identification of a tandem duplicated array in the Rhox alpha locus
            on mouse chromosome X
  JOURNAL   Mamm Genome 17 (2), 178-187 (2006)
   PUBMED   16465597
REFERENCE   4  (bases 1 to 977)
  AUTHORS   Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML,
            Macleod C and Wilkinson MF.
  TITLE     Rhox: a new homeobox gene cluster
  JOURNAL   Cell 120 (3), 369-382 (2005)
   PUBMED   15707895
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AJ972669.1.
            
            On Mar 7, 2006 this sequence version replaced NM_201236.2.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AJ972669.1, BC094891.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN01164134, SAMN01164142
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on expression, longest protein
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..977
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="X"
                     /map="X 21.86 cM"
     gene            1..977
                     /gene="Rhox4e"
                     /gene_synonym="Rhox4; Rhox4.5; Rhox4d"
                     /note="reproductive homeobox 4E"
                     /db_xref="GeneID:194856"
                     /db_xref="MGI:MGI:3613390"
     exon            1..289
                     /gene="Rhox4e"
                     /gene_synonym="Rhox4; Rhox4.5; Rhox4d"
                     /inference="alignment:Splign:2.1.0"
     CDS             223..840
                     /gene="Rhox4e"
                     /gene_synonym="Rhox4; Rhox4.5; Rhox4d"
                     /codon_start=1
                     /product="reproductive homeobox 4E"
                     /protein_id="NP_957688.2"
                     /db_xref="CCDS:CCDS30078.1"
                     /db_xref="GeneID:194856"
                     /db_xref="MGI:MGI:3613390"
                     /translation="

MEHQNTNYLLHEGLGKDKENLNGGKTQAVLPLDGEGRNEGESVLGQSGAAAVEWDKAEELSGEGGPAAGDADLMDNSNQEDQDTSGSAQEEEKLPEEPVLRDAVVIDKVQPIPVLVSGVRPKSVWVQQRSLHYNFQWWQLQELERIFQQNHFIRAEERRHLARWIGVSETRVKRWFKKRREHFRRGQSQLGMNDDAPVGSHSTFL"

     misc_feature    607..783
                     /gene="Rhox4e"
                     /gene_synonym="Rhox4; Rhox4.5; Rhox4d"
                     /note="Homeodomain; DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:238039"
     misc_feature    order(607..621,625..627,676..678,694..696,733..735,
                     739..744,751..756,760..768,772..777)
                     /gene="Rhox4e"
                     /gene_synonym="Rhox4; Rhox4.5; Rhox4d"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(613..615,622..624,742..744,751..756,763..765)
                     /gene="Rhox4e"
                     /gene_synonym="Rhox4; Rhox4.5; Rhox4d"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            290..695
                     /gene="Rhox4e"
                     /gene_synonym="Rhox4; Rhox4.5; Rhox4d"
                     /inference="alignment:Splign:2.1.0"
     exon            696..741
                     /gene="Rhox4e"
                     /gene_synonym="Rhox4; Rhox4.5; Rhox4d"
                     /inference="alignment:Splign:2.1.0"
     exon            742..977
                     /gene="Rhox4e"
                     /gene_synonym="Rhox4; Rhox4.5; Rhox4d"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

ctcttcctggttgcaaagctaggttttcggctctcagctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctgtcggctttcggctttcggttttcacaacctcaggaactccgactcagaatctgctggggaaagctgcagggaagcactcaggacatggagcatcaaaacaccaactacctacttcatgagggacttggcaaggacaaggaaaatttgaatggtgggaagacacaggcagtcttaccactggatggagagggaagaaatgagggagagagtgtactgggccagtccggagccgcagcagtggaatgggacaaagcagaagaattaagtggagaaggtgggcctgctgctggtgatgcagacctcatggataacagcaaccaagaggaccaggacaccagtggcagtgcccaggaggaggagaagctgccagaggagccagttctcagggatgctgtggtcatagacaaagtgcagcctattccagtgctggtatctggtgtgcggcctaagtcagtgtgggtacagcagcgtagcttacactacaatttccaatggtggcagctgcaggagctggagcgcattttccagcagaatcacttcatccgtgcagaggaaagaagacatctggcaagatggataggtgtgagtgaaaccagagttaagagatggtttaagaagaggagagagcacttcagaagaggacaaagtcagttaggaatgaatgatgatgcccctgtggggtcccactctacctttctctgaagatggcacaggaggcctggtgtaccacccttgaccaggagccacgtgcagacccctgctgccttccaccagcatgttattgcatctctattccctaagcatttgtatgtgaaataaatagattctcagtttctttg

//