2024-09-28 09:24:54, GGRNA.v2 : RefSeq release 225 (Jul, 2024)
LOCUS NM_201236 977 bp mRNA linear ROD 04-AUG-2023 DEFINITION Mus musculus reproductive homeobox 4E (Rhox4e), mRNA. ACCESSION NM_201236 XM_109566 VERSION NM_201236.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 977) AUTHORS Thompson CL, Ng L, Menon V, Martinez S, Lee CK, Glattfelder K, Sunkin SM, Henry A, Lau C, Dang C, Garcia-Lopez R, Martinez-Ferre A, Pombero A, Rubenstein JLR, Wakeman WB, Hohmann J, Dee N, Sodt AJ, Young R, Smith K, Nguyen TN, Kidney J, Kuan L, Jeromin A, Kaykas A, Miller J, Page D, Orta G, Bernard A, Riley Z, Smith S, Wohnoutka P, Hawrylycz MJ, Puelles L and Jones AR. TITLE A high-resolution spatiotemporal atlas of gene expression of the developing mouse brain JOURNAL Neuron 83 (2), 309-323 (2014) PUBMED 24952961 REFERENCE 2 (bases 1 to 977) AUTHORS MacLean,J.A. 2nd, Lorenzetti,D., Hu,Z., Salerno,W.J., Miller,J. and Wilkinson,M.F. TITLE Rhox homeobox gene cluster: recent duplication of three family members JOURNAL Genesis 44 (3), 122-129 (2006) PUBMED 16496311 REFERENCE 3 (bases 1 to 977) AUTHORS Morris L, Gordon J and Blackburn CC. TITLE Identification of a tandem duplicated array in the Rhox alpha locus on mouse chromosome X JOURNAL Mamm Genome 17 (2), 178-187 (2006) PUBMED 16465597 REFERENCE 4 (bases 1 to 977) AUTHORS Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML, Macleod C and Wilkinson MF. TITLE Rhox: a new homeobox gene cluster JOURNAL Cell 120 (3), 369-382 (2005) PUBMED 15707895 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AJ972669.1. On Mar 7, 2006 this sequence version replaced NM_201236.2. ##Evidence-Data-START## Transcript exon combination :: AJ972669.1, BC094891.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN01164134, SAMN01164142 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on expression, longest protein ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. FEATURES Location/Qualifiers source 1..977 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="X" /map="X 21.86 cM" gene 1..977 /gene="Rhox4e" /gene_synonym="Rhox4; Rhox4.5; Rhox4d" /note="reproductive homeobox 4E" /db_xref="GeneID:194856" /db_xref="MGI:MGI:3613390" exon 1..289 /gene="Rhox4e" /gene_synonym="Rhox4; Rhox4.5; Rhox4d" /inference="alignment:Splign:2.1.0" CDS 223..840 /gene="Rhox4e" /gene_synonym="Rhox4; Rhox4.5; Rhox4d" /codon_start=1 /product="reproductive homeobox 4E" /protein_id="NP_957688.2" /db_xref="CCDS:CCDS30078.1" /db_xref="GeneID:194856" /db_xref="MGI:MGI:3613390" /translation="
MEHQNTNYLLHEGLGKDKENLNGGKTQAVLPLDGEGRNEGESVLGQSGAAAVEWDKAEELSGEGGPAAGDADLMDNSNQEDQDTSGSAQEEEKLPEEPVLRDAVVIDKVQPIPVLVSGVRPKSVWVQQRSLHYNFQWWQLQELERIFQQNHFIRAEERRHLARWIGVSETRVKRWFKKRREHFRRGQSQLGMNDDAPVGSHSTFL"
misc_feature 607..783 /gene="Rhox4e" /gene_synonym="Rhox4; Rhox4.5; Rhox4d" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:238039" misc_feature order(607..621,625..627,676..678,694..696,733..735, 739..744,751..756,760..768,772..777) /gene="Rhox4e" /gene_synonym="Rhox4; Rhox4.5; Rhox4d" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(613..615,622..624,742..744,751..756,763..765) /gene="Rhox4e" /gene_synonym="Rhox4; Rhox4.5; Rhox4d" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 290..695 /gene="Rhox4e" /gene_synonym="Rhox4; Rhox4.5; Rhox4d" /inference="alignment:Splign:2.1.0" exon 696..741 /gene="Rhox4e" /gene_synonym="Rhox4; Rhox4.5; Rhox4d" /inference="alignment:Splign:2.1.0" exon 742..977 /gene="Rhox4e" /gene_synonym="Rhox4; Rhox4.5; Rhox4d" /inference="alignment:Splign:2.1.0" ORIGIN
ctcttcctggttgcaaagctaggttttcggctctcagctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctgtcggctttcggctttcggttttcacaacctcaggaactccgactcagaatctgctggggaaagctgcagggaagcactcaggacatggagcatcaaaacaccaactacctacttcatgagggacttggcaaggacaaggaaaatttgaatggtgggaagacacaggcagtcttaccactggatggagagggaagaaatgagggagagagtgtactgggccagtccggagccgcagcagtggaatgggacaaagcagaagaattaagtggagaaggtgggcctgctgctggtgatgcagacctcatggataacagcaaccaagaggaccaggacaccagtggcagtgcccaggaggaggagaagctgccagaggagccagttctcagggatgctgtggtcatagacaaagtgcagcctattccagtgctggtatctggtgtgcggcctaagtcagtgtgggtacagcagcgtagcttacactacaatttccaatggtggcagctgcaggagctggagcgcattttccagcagaatcacttcatccgtgcagaggaaagaagacatctggcaagatggataggtgtgagtgaaaccagagttaagagatggtttaagaagaggagagagcacttcagaagaggacaaagtcagttaggaatgaatgatgatgcccctgtggggtcccactctacctttctctgaagatggcacaggaggcctggtgtaccacccttgaccaggagccacgtgcagacccctgctgccttccaccagcatgttattgcatctctattccctaagcatttgtatgtgaaataaatagattctcagtttctttg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]