GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-11 14:33:36, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_198598                805 bp    mRNA    linear   ROD 04-AUG-2023
DEFINITION  Mus musculus reproductive homeobox 11 (Rhox11), mRNA.
ACCESSION   NM_198598 XM_111890
VERSION     NM_198598.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 805)
  AUTHORS   Thompson CL, Ng L, Menon V, Martinez S, Lee CK, Glattfelder K,
            Sunkin SM, Henry A, Lau C, Dang C, Garcia-Lopez R, Martinez-Ferre
            A, Pombero A, Rubenstein JLR, Wakeman WB, Hohmann J, Dee N, Sodt
            AJ, Young R, Smith K, Nguyen TN, Kidney J, Kuan L, Jeromin A,
            Kaykas A, Miller J, Page D, Orta G, Bernard A, Riley Z, Smith S,
            Wohnoutka P, Hawrylycz MJ, Puelles L and Jones AR.
  TITLE     A high-resolution spatiotemporal atlas of gene expression of the
            developing mouse brain
  JOURNAL   Neuron 83 (2), 309-323 (2014)
   PUBMED   24952961
REFERENCE   2  (bases 1 to 805)
  AUTHORS   Daggag H, Svingen T, Western PS, van den Bergen JA, McClive PJ,
            Harley VR, Koopman P and Sinclair AH.
  TITLE     The rhox homeobox gene family shows sexually dimorphic and dynamic
            expression during mouse embryonic gonad development
  JOURNAL   Biol Reprod 79 (3), 468-474 (2008)
   PUBMED   18562707
REFERENCE   3  (bases 1 to 805)
  AUTHORS   Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML,
            Macleod C and Wilkinson MF.
  TITLE     Rhox: a new homeobox gene cluster
  JOURNAL   Cell 120 (3), 369-382 (2005)
   PUBMED   15707895
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BC049711.1.
            
            On Apr 7, 2006 this sequence version replaced NM_198598.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: DQ058648.1, BC049711.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849384 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-805               BC049711.1         3-807
FEATURES             Location/Qualifiers
     source          1..805
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10090"
                     /chromosome="X"
                     /map="X 22.33 cM"
     gene            1..805
                     /gene="Rhox11"
                     /gene_synonym="Gm39"
                     /note="reproductive homeobox 11"
                     /db_xref="GeneID:194738"
                     /db_xref="MGI:MGI:2681831"
     exon            1..521
                     /gene="Rhox11"
                     /gene_synonym="Gm39"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    157..159
                     /gene="Rhox11"
                     /gene_synonym="Gm39"
                     /note="upstream in-frame stop codon"
     CDS             163..783
                     /gene="Rhox11"
                     /gene_synonym="Gm39"
                     /codon_start=1
                     /product="reproductive homeobox on X chromosome, 11"
                     /protein_id="NP_941000.1"
                     /db_xref="CCDS:CCDS30086.1"
                     /db_xref="GeneID:194738"
                     /db_xref="MGI:MGI:2681831"
                     /translation="
MSRKYFYFDYDYYGMSFCEEEITTEPEEKVAYTSNSGGFADEVTGIPKEGHQSSIGEHSCVMPNTQDTGREEPEETSKVAETSEQSLFRIPRKAYRFTPGQLWELQAVFVENQYPDALKRKELAGLLNVDEQKIKDWFNNKRAKYRKIQREILGGKNITPTQEELRMKTLVESKKIIIFQEQEGDGLFWEHQNIDTQNSPLSLLFS"
     misc_feature    448..603
                     /gene="Rhox11"
                     /gene_synonym="Gm39"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            522..567
                     /gene="Rhox11"
                     /gene_synonym="Gm39"
                     /inference="alignment:Splign:2.1.0"
     exon            568..805
                     /gene="Rhox11"
                     /gene_synonym="Gm39"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ctcacacaggtttgtgagttgaaagccagtagcatcggtggaggaggacgagtgtctgtgtcagagaggaacgtgtgtagcctagggtaacaatttagagggcttcaaggagcagagccccattggaaaccacaagagtgtgccttctgacgagcatagatcatgtcccgtaagtacttctacttcgactacgactactatgggatgagcttctgtgaggaagaaatcacgactgaacccgaggaaaaggtggcctacacatcaaacagtggcggcttcgccgatgaagtaacaggcatcccgaaagagggccaccagagctctataggcgagcatagctgtgtcatgcctaacactcaggacactgggcgagaagagccagaggagaccagtaaggtggccgagaccagtgagcagtcgttattcaggattcctcggaaagcatacagatttacacctggacagctgtgggaactgcaagcagtgttcgtagaaaatcagtatccagatgccctcaaaagaaaagagctggcagggctcctgaatgtggatgaacagaaaataaaggattggttcaacaataagagagctaaatataggaagattcagagggaaatactggggggcaagaacatcactcctacccaggaagaacttcgcatgaagactttggtggaatccaagaaaatcatcattttccaggagcaagagggggatgggcttttctgggaacaccagaacattgacacccaaaacagccctctctctcttctcttcagttagcaataaagtacaggattttcca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]