2025-09-18 02:21:29, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS NM_198598 805 bp mRNA linear ROD 04-AUG-2023 DEFINITION Mus musculus reproductive homeobox 11 (Rhox11), mRNA. ACCESSION NM_198598 XM_111890 VERSION NM_198598.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 805) AUTHORS Thompson CL, Ng L, Menon V, Martinez S, Lee CK, Glattfelder K, Sunkin SM, Henry A, Lau C, Dang C, Garcia-Lopez R, Martinez-Ferre A, Pombero A, Rubenstein JLR, Wakeman WB, Hohmann J, Dee N, Sodt AJ, Young R, Smith K, Nguyen TN, Kidney J, Kuan L, Jeromin A, Kaykas A, Miller J, Page D, Orta G, Bernard A, Riley Z, Smith S, Wohnoutka P, Hawrylycz MJ, Puelles L and Jones AR. TITLE A high-resolution spatiotemporal atlas of gene expression of the developing mouse brain JOURNAL Neuron 83 (2), 309-323 (2014) PUBMED 24952961 REFERENCE 2 (bases 1 to 805) AUTHORS Daggag H, Svingen T, Western PS, van den Bergen JA, McClive PJ, Harley VR, Koopman P and Sinclair AH. TITLE The rhox homeobox gene family shows sexually dimorphic and dynamic expression during mouse embryonic gonad development JOURNAL Biol Reprod 79 (3), 468-474 (2008) PUBMED 18562707 REFERENCE 3 (bases 1 to 805) AUTHORS Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML, Macleod C and Wilkinson MF. TITLE Rhox: a new homeobox gene cluster JOURNAL Cell 120 (3), 369-382 (2005) PUBMED 15707895 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BC049711.1. On Apr 7, 2006 this sequence version replaced NM_198598.1. ##Evidence-Data-START## Transcript exon combination :: DQ058648.1, BC049711.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849384 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-805 BC049711.1 3-807 FEATURES Location/Qualifiers source 1..805 /organism="Mus musculus" /mol_type="mRNA" /db_xref="taxon:10090" /chromosome="X" /map="X 22.33 cM" gene 1..805 /gene="Rhox11" /gene_synonym="Gm39" /note="reproductive homeobox 11" /db_xref="GeneID:194738" /db_xref="MGI:MGI:2681831" exon 1..521 /gene="Rhox11" /gene_synonym="Gm39" /inference="alignment:Splign:2.1.0" misc_feature 157..159 /gene="Rhox11" /gene_synonym="Gm39" /note="upstream in-frame stop codon" CDS 163..783 /gene="Rhox11" /gene_synonym="Gm39" /codon_start=1 /product="reproductive homeobox on X chromosome, 11" /protein_id="NP_941000.1" /db_xref="CCDS:CCDS30086.1" /db_xref="GeneID:194738" /db_xref="MGI:MGI:2681831" /translation="
MSRKYFYFDYDYYGMSFCEEEITTEPEEKVAYTSNSGGFADEVTGIPKEGHQSSIGEHSCVMPNTQDTGREEPEETSKVAETSEQSLFRIPRKAYRFTPGQLWELQAVFVENQYPDALKRKELAGLLNVDEQKIKDWFNNKRAKYRKIQREILGGKNITPTQEELRMKTLVESKKIIIFQEQEGDGLFWEHQNIDTQNSPLSLLFS"
misc_feature 448..603 /gene="Rhox11" /gene_synonym="Gm39" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" exon 522..567 /gene="Rhox11" /gene_synonym="Gm39" /inference="alignment:Splign:2.1.0" exon 568..805 /gene="Rhox11" /gene_synonym="Gm39" /inference="alignment:Splign:2.1.0" ORIGIN
ctcacacaggtttgtgagttgaaagccagtagcatcggtggaggaggacgagtgtctgtgtcagagaggaacgtgtgtagcctagggtaacaatttagagggcttcaaggagcagagccccattggaaaccacaagagtgtgccttctgacgagcatagatcatgtcccgtaagtacttctacttcgactacgactactatgggatgagcttctgtgaggaagaaatcacgactgaacccgaggaaaaggtggcctacacatcaaacagtggcggcttcgccgatgaagtaacaggcatcccgaaagagggccaccagagctctataggcgagcatagctgtgtcatgcctaacactcaggacactgggcgagaagagccagaggagaccagtaaggtggccgagaccagtgagcagtcgttattcaggattcctcggaaagcatacagatttacacctggacagctgtgggaactgcaagcagtgttcgtagaaaatcagtatccagatgccctcaaaagaaaagagctggcagggctcctgaatgtggatgaacagaaaataaaggattggttcaacaataagagagctaaatataggaagattcagagggaaatactggggggcaagaacatcactcctacccaggaagaacttcgcatgaagactttggtggaatccaagaaaatcatcattttccaggagcaagagggggatgggcttttctgggaacaccagaacattgacacccaaaacagccctctctctcttctcttcagttagcaataaagtacaggattttcca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]