ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-09-15 11:56:34, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_181490 1172 bp mRNA linear ROD 20-JUN-2025 DEFINITION Mus musculus claudin 17 (Cldn17), mRNA. ACCESSION NM_181490 VERSION NM_181490.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1172) AUTHORS Adil,M.S., Parvathagiri,V., Verma,A., Liu,F., Rudraraju,M., Narayanan,S.P. and Somanath,P.R. TITLE Claudin-17 Deficiency in Mice Results in Kidney Injury Due to Electrolyte Imbalance and Oxidative Stress JOURNAL Cells 11 (11), 1782 (2022) PUBMED 35681477 REMARK GeneRIF: Claudin-17 Deficiency in Mice Results in Kidney Injury Due to Electrolyte Imbalance and Oxidative Stress. Publication Status: Online-Only REFERENCE 2 (bases 1 to 1172) AUTHORS Higashi,A.Y., Higashi,T., Furuse,K., Ozeki,K., Furuse,M. and Chiba,H. TITLE Claudin-9 constitutes tight junctions of folliculo-stellate cells in the anterior pituitary gland JOURNAL Sci Rep 11 (1), 21642 (2021) PUBMED 34737342 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1172) AUTHORS Krug,S.M., Gunzel,D., Conrad,M.P., Rosenthal,R., Fromm,A., Amasheh,S., Schulzke,J.D. and Fromm,M. TITLE Claudin-17 forms tight junction channels with distinct anion selectivity JOURNAL Cell Mol Life Sci 69 (16), 2765-2778 (2012) PUBMED 22402829 REFERENCE 4 (bases 1 to 1172) AUTHORS Westmoreland,J.J., Drosos,Y., Kelly,J., Ye,J., Means,A.L., Washington,M.K. and Sosa-Pineda,B. TITLE Dynamic distribution of claudin proteins in pancreatic epithelia undergoing morphogenesis or neoplastic transformation JOURNAL Dev Dyn 241 (3), 583-594 (2012) PUBMED 22275141 REFERENCE 5 (bases 1 to 1172) AUTHORS Patel,R.M., Myers,L.S., Kurundkar,A.R., Maheshwari,A., Nusrat,A. and Lin,P.W. TITLE Probiotic bacteria induce maturation of intestinal claudin 3 expression and barrier function JOURNAL Am J Pathol 180 (2), 626-635 (2012) PUBMED 22155109 REMARK Erratum:[Am J Pathol. 2012 Mar;180(3):1324. doi: 10.1016/j.ajpath.2011.12.010. PMID: 32455526] REFERENCE 6 (bases 1 to 1172) AUTHORS Lal-Nag,M. and Morin,P.J. TITLE The claudins JOURNAL Genome Biol 10 (8), 235 (2009) PUBMED 19706201 REMARK Review article REFERENCE 7 (bases 1 to 1172) AUTHORS Angelow,S., Ahlstrom,R. and Yu,A.S. TITLE Biology of claudins JOURNAL Am J Physiol Renal Physiol 295 (4), F867-F876 (2008) PUBMED 18480174 REMARK Review article REFERENCE 8 (bases 1 to 1172) AUTHORS Krause,G., Winkler,L., Mueller,S.L., Haseloff,R.F., Piontek,J. and Blasig,I.E. TITLE Structure and function of claudins JOURNAL Biochim Biophys Acta 1778 (3), 631-645 (2008) PUBMED 18036336 REMARK Review article COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK048287.1. On Apr 5, 2007 this sequence version replaced NM_181490.2. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is intronless and is clustered with the Cldn8 gene on chromosome 16. [provided by RefSeq, Aug 2010]. ##Evidence-Data-START## Transcript is intronless :: AK048287.1 [ECO:0000345] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1172 AK048287.1 3-1174 FEATURES Location/Qualifiers source 1..1172 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="16" /map="16 51.12 cM" gene 1..1172 /gene="Cldn17" /note="claudin 17" /db_xref="GeneID:239931" /db_xref="MGI:MGI:2652030" exon 1..1172 /gene="Cldn17" /inference="alignment:Splign:2.1.0" CDS 140..814 /gene="Cldn17" /codon_start=1 /product="claudin-17" /protein_id="NP_852467.1" /db_xref="CCDS:CCDS28295.1" /db_xref="GeneID:239931" /db_xref="MGI:MGI:2652030" /translation="
MAFYPLQIAGLVLGFFGLVGTIGTTLLPQWRVSAFIGSNIIIFERIWEGLWMNCIQQAMVTLQCKFYNSILALPPVLEAARALMCVAVALALVALIIGICGMKQLQCTGSSERVKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYDPTVHAGQKRELGGALFLGWATAAVLFIGGGLLCGYCCCNRKERWHRYPVPAYRVPQKDNQRNVTVPRKSSTSYV"
misc_feature 155..685
/gene="Cldn17"
/note="PMP-22/EMP/MP20/Claudin family; Region:
PMP22_Claudin; cl21598"
/db_xref="CDD:473919"
misc_feature 161..223
/gene="Cldn17"
/note="propagated from UniProtKB/Swiss-Prot (Q8BXA6.1);
transmembrane region"
misc_feature 383..445
/gene="Cldn17"
/note="propagated from UniProtKB/Swiss-Prot (Q8BXA6.1);
transmembrane region"
misc_feature 512..574
/gene="Cldn17"
/note="propagated from UniProtKB/Swiss-Prot (Q8BXA6.1);
transmembrane region"
misc_feature 632..694
/gene="Cldn17"
/note="propagated from UniProtKB/Swiss-Prot (Q8BXA6.1);
transmembrane region"
ORIGIN
gctgatttggacgaacacatcatgggtatcaggagcggagaagaccaggcactcctctagactagaagactcctacacattctgcatcttgactgtcttccttcccttccaggctgaagcagtaggccaaggaaagacaatggctttttatcccttacagatcgctggactagttcttggattcttcggtttggttgggacgattgggacaacacttctgcctcaatggagagtgtcagctttcatcggcagcaacattattatctttgagaggatctgggaagggctttggatgaactgcatccagcaagctatggtcaccttgcagtgcaaattctataactccatattggctctccctccggtactggaagcagcgcgtgccctcatgtgtgtggctgtggctcttgccttggttgctctcattattggcatctgcggcatgaaacagctccagtgcaccggctccagcgagagggtcaaagcctacttgcttggaacctcaggggtgctctttattctgactggtatcttcgttctgattccagtgtcctggactgctaatatcatcatcagagatttctacgacccaaccgttcatgcagggcagaagcgagaacttggaggagcactcttccttggctgggcaaccgctgctgtcctcttcattggaggcgggctgctctgcggatattgctgctgcaacagaaaggaacggtggcacagatacccagtccctgcataccgcgtgccacagaaggataaccaaaggaatgttactgtgcctagaaaatcttccaccagctacgtctaaggcttacttccaacatcagtccctggcttatgctcatgtgttttataaagtcaccccagaaactgtgagtacttcaggcagaactacttttataggagatataaattgagatgaaagttgtgattttttcccctgaggtaggaatataaatgacttatttggacattgtgattccctgggtgttatttgtgctcactcttgttgaactcaatatttattctaatgtatatagtaaaatatcaagtatattctcagtttgggcatgtgataatgattactaaattttgcttgttattataataagaaagtaaaatgttacattataattgatataaataaaacatacccgttttcaagc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]