GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-09-15 11:56:34, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_181490               1172 bp    mRNA    linear   ROD 20-JUN-2025
DEFINITION  Mus musculus claudin 17 (Cldn17), mRNA.
ACCESSION   NM_181490
VERSION     NM_181490.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1172)
  AUTHORS   Adil,M.S., Parvathagiri,V., Verma,A., Liu,F., Rudraraju,M.,
            Narayanan,S.P. and Somanath,P.R.
  TITLE     Claudin-17 Deficiency in Mice Results in Kidney Injury Due to
            Electrolyte Imbalance and Oxidative Stress
  JOURNAL   Cells 11 (11), 1782 (2022)
   PUBMED   35681477
  REMARK    GeneRIF: Claudin-17 Deficiency in Mice Results in Kidney Injury Due
            to Electrolyte Imbalance and Oxidative Stress.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1172)
  AUTHORS   Higashi,A.Y., Higashi,T., Furuse,K., Ozeki,K., Furuse,M. and
            Chiba,H.
  TITLE     Claudin-9 constitutes tight junctions of folliculo-stellate cells
            in the anterior pituitary gland
  JOURNAL   Sci Rep 11 (1), 21642 (2021)
   PUBMED   34737342
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1172)
  AUTHORS   Krug,S.M., Gunzel,D., Conrad,M.P., Rosenthal,R., Fromm,A.,
            Amasheh,S., Schulzke,J.D. and Fromm,M.
  TITLE     Claudin-17 forms tight junction channels with distinct anion
            selectivity
  JOURNAL   Cell Mol Life Sci 69 (16), 2765-2778 (2012)
   PUBMED   22402829
REFERENCE   4  (bases 1 to 1172)
  AUTHORS   Westmoreland,J.J., Drosos,Y., Kelly,J., Ye,J., Means,A.L.,
            Washington,M.K. and Sosa-Pineda,B.
  TITLE     Dynamic distribution of claudin proteins in pancreatic epithelia
            undergoing morphogenesis or neoplastic transformation
  JOURNAL   Dev Dyn 241 (3), 583-594 (2012)
   PUBMED   22275141
REFERENCE   5  (bases 1 to 1172)
  AUTHORS   Patel,R.M., Myers,L.S., Kurundkar,A.R., Maheshwari,A., Nusrat,A.
            and Lin,P.W.
  TITLE     Probiotic bacteria induce maturation of intestinal claudin 3
            expression and barrier function
  JOURNAL   Am J Pathol 180 (2), 626-635 (2012)
   PUBMED   22155109
  REMARK    Erratum:[Am J Pathol. 2012 Mar;180(3):1324. doi:
            10.1016/j.ajpath.2011.12.010. PMID: 32455526]
REFERENCE   6  (bases 1 to 1172)
  AUTHORS   Lal-Nag,M. and Morin,P.J.
  TITLE     The claudins
  JOURNAL   Genome Biol 10 (8), 235 (2009)
   PUBMED   19706201
  REMARK    Review article
REFERENCE   7  (bases 1 to 1172)
  AUTHORS   Angelow,S., Ahlstrom,R. and Yu,A.S.
  TITLE     Biology of claudins
  JOURNAL   Am J Physiol Renal Physiol 295 (4), F867-F876 (2008)
   PUBMED   18480174
  REMARK    Review article
REFERENCE   8  (bases 1 to 1172)
  AUTHORS   Krause,G., Winkler,L., Mueller,S.L., Haseloff,R.F., Piontek,J. and
            Blasig,I.E.
  TITLE     Structure and function of claudins
  JOURNAL   Biochim Biophys Acta 1778 (3), 631-645 (2008)
   PUBMED   18036336
  REMARK    Review article
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AK048287.1.
            
            On Apr 5, 2007 this sequence version replaced NM_181490.2.
            
            Summary: This gene encodes a member of the claudin family. Claudins
            are integral membrane proteins and components of tight junction
            strands. Tight junction strands serve as a physical barrier to
            prevent solutes and water from passing freely through the
            paracellular space between epithelial or endothelial cell sheets,
            and also play critical roles in maintaining cell polarity and
            signal transductions. This gene is intronless and is clustered with
            the Cldn8 gene on chromosome 16. [provided by RefSeq, Aug 2010].
            
            ##Evidence-Data-START##
            Transcript is intronless :: AK048287.1 [ECO:0000345]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1172              AK048287.1         3-1174
FEATURES             Location/Qualifiers
     source          1..1172
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="16"
                     /map="16 51.12 cM"
     gene            1..1172
                     /gene="Cldn17"
                     /note="claudin 17"
                     /db_xref="GeneID:239931"
                     /db_xref="MGI:MGI:2652030"
     exon            1..1172
                     /gene="Cldn17"
                     /inference="alignment:Splign:2.1.0"
     CDS             140..814
                     /gene="Cldn17"
                     /codon_start=1
                     /product="claudin-17"
                     /protein_id="NP_852467.1"
                     /db_xref="CCDS:CCDS28295.1"
                     /db_xref="GeneID:239931"
                     /db_xref="MGI:MGI:2652030"
                     /translation="
MAFYPLQIAGLVLGFFGLVGTIGTTLLPQWRVSAFIGSNIIIFERIWEGLWMNCIQQAMVTLQCKFYNSILALPPVLEAARALMCVAVALALVALIIGICGMKQLQCTGSSERVKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYDPTVHAGQKRELGGALFLGWATAAVLFIGGGLLCGYCCCNRKERWHRYPVPAYRVPQKDNQRNVTVPRKSSTSYV"
     misc_feature    155..685
                     /gene="Cldn17"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
     misc_feature    161..223
                     /gene="Cldn17"
                     /note="propagated from UniProtKB/Swiss-Prot (Q8BXA6.1);
                     transmembrane region"
     misc_feature    383..445
                     /gene="Cldn17"
                     /note="propagated from UniProtKB/Swiss-Prot (Q8BXA6.1);
                     transmembrane region"
     misc_feature    512..574
                     /gene="Cldn17"
                     /note="propagated from UniProtKB/Swiss-Prot (Q8BXA6.1);
                     transmembrane region"
     misc_feature    632..694
                     /gene="Cldn17"
                     /note="propagated from UniProtKB/Swiss-Prot (Q8BXA6.1);
                     transmembrane region"
ORIGIN      
gctgatttggacgaacacatcatgggtatcaggagcggagaagaccaggcactcctctagactagaagactcctacacattctgcatcttgactgtcttccttcccttccaggctgaagcagtaggccaaggaaagacaatggctttttatcccttacagatcgctggactagttcttggattcttcggtttggttgggacgattgggacaacacttctgcctcaatggagagtgtcagctttcatcggcagcaacattattatctttgagaggatctgggaagggctttggatgaactgcatccagcaagctatggtcaccttgcagtgcaaattctataactccatattggctctccctccggtactggaagcagcgcgtgccctcatgtgtgtggctgtggctcttgccttggttgctctcattattggcatctgcggcatgaaacagctccagtgcaccggctccagcgagagggtcaaagcctacttgcttggaacctcaggggtgctctttattctgactggtatcttcgttctgattccagtgtcctggactgctaatatcatcatcagagatttctacgacccaaccgttcatgcagggcagaagcgagaacttggaggagcactcttccttggctgggcaaccgctgctgtcctcttcattggaggcgggctgctctgcggatattgctgctgcaacagaaaggaacggtggcacagatacccagtccctgcataccgcgtgccacagaaggataaccaaaggaatgttactgtgcctagaaaatcttccaccagctacgtctaaggcttacttccaacatcagtccctggcttatgctcatgtgttttataaagtcaccccagaaactgtgagtacttcaggcagaactacttttataggagatataaattgagatgaaagttgtgattttttcccctgaggtaggaatataaatgacttatttggacattgtgattccctgggtgttatttgtgctcactcttgttgaactcaatatttattctaatgtatatagtaaaatatcaagtatattctcagtttgggcatgtgataatgattactaaattttgcttgttattataataagaaagtaaaatgttacattataattgatataaataaaacatacccgttttcaagc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]