2024-09-28 09:26:18, GGRNA.v2 : RefSeq release 225 (Jul, 2024)
LOCUS NM_030057 1283 bp mRNA linear ROD 05-JUN-2024 DEFINITION Mus musculus trafficking protein particle complex 6B (Trappc6b), transcript variant 1, mRNA. ACCESSION NM_030057 XM_127025 VERSION NM_030057.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1283) AUTHORS Kim,J.J., Lipatova,Z. and Segev,N. TITLE TRAPP Complexes in Secretion and Autophagy JOURNAL Front Cell Dev Biol 4, 20 (2016) PUBMED 27066478 REMARK Review article Publication Status: Online-Only REFERENCE 2 (bases 1 to 1283) AUTHORS Pan,J., Mor,G., Ju,W., Zhong,J., Luo,X., Aldo,P.B., Zhong,M., Yu,Y., Jenkins,E.C., Brown,W.T. and Zhong,N. TITLE Viral Infection-Induced Differential Expression of LncRNAs Associated with Collagen in Mouse Placentas and Amniotic Sacs JOURNAL Am J Reprod Immunol 74 (3), 237-257 (2015) PUBMED 26073538 REFERENCE 3 (bases 1 to 1283) AUTHORS Hughes,D.S., Keynes,R.J. and Tannahill,D. TITLE Extensive molecular differences between anterior- and posterior-half-sclerotomes underlie somite polarity and spinal nerve segmentation JOURNAL BMC Dev Biol 9, 30 (2009) PUBMED 19463158 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 1283) AUTHORS Evsikov,A.V., Graber,J.H., Brockman,J.M., Hampl,A., Holbrook,A.E., Singh,P., Eppig,J.J., Solter,D. and Knowles,B.B. TITLE Cracking the egg: molecular dynamics and evolutionary aspects of the transition from the fully grown oocyte to embryo JOURNAL Genes Dev 20 (19), 2713-2727 (2006) PUBMED 17015433 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DV660612.1, AK020026.1 and CO039101.1. On Apr 16, 2015 this sequence version replaced NM_030057.2. Transcript Variant: This variant (1) encodes the longest isoform (1). ##Evidence-Data-START## Transcript exon combination :: AK046610.1, BC031464.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849375, SAMN00849381 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-68 DV660612.1 16-83 69-1076 AK020026.1 38-1045 1077-1283 CO039101.1 1-207 c FEATURES Location/Qualifiers source 1..1283 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="12" /map="12 25.99 cM" gene 1..1283 /gene="Trappc6b" /gene_synonym="5830498C14Rik" /note="trafficking protein particle complex 6B" /db_xref="GeneID:78232" /db_xref="MGI:MGI:1925482" exon 1..317 /gene="Trappc6b" /gene_synonym="5830498C14Rik" /inference="alignment:Splign:2.1.0" misc_feature 198..200 /gene="Trappc6b" /gene_synonym="5830498C14Rik" /note="upstream in-frame stop codon" CDS 237..713 /gene="Trappc6b" /gene_synonym="5830498C14Rik" /note="isoform 1 is encoded by transcript variant 1; trafficking protein particle complex subunit 6B; TRAPP complex subunit 6B" /codon_start=1 /product="trafficking protein particle complex subunit 6B isoform 1" /protein_id="NP_084333.1" /db_xref="CCDS:CCDS25932.1" /db_xref="GeneID:78232" /db_xref="MGI:MGI:1925482" /translation="
MADEALFLLLHNEMVSGVYKSAEQGEVENGRCVTKLESMGFRVGQGLIERFTKDTARFKDELDIMKFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLIQLSAGKQYLEHASKYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKFQVMIQKL"
misc_feature 243..704 /gene="Trappc6b" /gene_synonym="5830498C14Rik" /note="Trs33 subunit of the TRAPP complex; Region: TRAPPC6A_Trs33; cd14944" /db_xref="CDD:271347" misc_feature order(249..251,258..260,270..272,543..548,576..578, 588..590) /gene="Trappc6b" /gene_synonym="5830498C14Rik" /note="synbindin interface [polypeptide binding]; other site" /db_xref="CDD:271347" misc_feature order(252..257,261..269,273..278,285..287,339..341, 351..353,360..365,372..377,384..386,459..461,468..470, 528..530,597..599) /gene="Trappc6b" /gene_synonym="5830498C14Rik" /note="BET3 interface [polypeptide binding]; other site" /db_xref="CDD:271347" exon 318..385 /gene="Trappc6b" /gene_synonym="5830498C14Rik" /inference="alignment:Splign:2.1.0" exon 386..503 /gene="Trappc6b" /gene_synonym="5830498C14Rik" /inference="alignment:Splign:2.1.0" exon 504..587 /gene="Trappc6b" /gene_synonym="5830498C14Rik" /inference="alignment:Splign:2.1.0" exon 588..681 /gene="Trappc6b" /gene_synonym="5830498C14Rik" /inference="alignment:Splign:2.1.0" exon 682..1266 /gene="Trappc6b" /gene_synonym="5830498C14Rik" /inference="alignment:Splign:2.1.0" regulatory 1207..1212 /regulatory_class="polyA_signal_sequence" /gene="Trappc6b" /gene_synonym="5830498C14Rik" /note="hexamer: AATACA" polyA_site 1228 /gene="Trappc6b" /gene_synonym="5830498C14Rik" /note="major polyA site" ORIGIN
ggaagtggctcaggctccacgcccagcgctatagtcttggcagagtgtggggctgtcacagggtctctagggcccagtggcggcggccccggggaggggcgcggtccacggcggccttccgcggccttaggacccgggtaggccgctgagcacggcgtgcggtgggcgcggggtaacgggaacctcgagtcccgcactgatcggagccgactcggcgctggagggatcggcgggaaatggcggacgaggcgttgtttttgcttctccataacgagatggtgtccggagtgtacaagtccgccgagcagggggaagtggaaaatggaaggtgtgttactaagctggagagcatggggttccgagtggggcaaggactgatagaaaggtttacgaaagatactgcaaggttcaaggatgaattagacatcatgaagttcatctgtaaagatttttggactacagtattcaagaaacagattgacaatctgaggacaaatcatcagggcatatatgtacttcaggacaacaaatttcgactactcattcagctgtctgcaggaaaacagtatttagaacatgcgtccaagtatctagcattcacatgtggcttaatcagaggtggtttgtcgaacttgggaataaaaagtattgtaacagctgaagtctcttcaatgcctgcctgcaaatttcaggtgatgatacagaagctgtagagcgagctggcgactcctgggcagagcgttgcacatcctgatttcacctcatcgttggttatctgcgttggagcaaatcgttatctcaccagagtcacatagaccaaatcaaagtagacacaggtcctttgaccatgacagaaactgactgacctattcagtgatttcagagaactagacaccaagatgcaaggctcttcattttaaacatctttatttccataggtgattagcatttaaccatcaataggaagtgaaactcagggtgtgttgaattgctgtattaaaaaaaatgcaccaatcagaatagtttgtgttcaaatgaccaaaatttgttgaactataaatctgttttagttatttaaaaaagcaaaccactatgttaaattaagcttaatttttattgtattgcttataatttatttctgtcgagagaattcatatgcttatgtaaggatatcatttatacattgtgtatatatgtgtatatataaatacatgcattactgtctaaattacttgaaagtttattttaatagacttgagtccttgaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]