2025-10-16 04:30:33, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_029383 1011 bp mRNA linear ROD 01-MAY-2025 DEFINITION Mus musculus claudin 22 (Cldn22), mRNA. ACCESSION NM_029383 XM_887785 XM_908254 VERSION NM_029383.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1011) AUTHORS Higashi,A.Y., Higashi,T., Furuse,K., Ozeki,K., Furuse,M. and Chiba,H. TITLE Claudin-9 constitutes tight junctions of folliculo-stellate cells in the anterior pituitary gland JOURNAL Sci Rep 11 (1), 21642 (2021) PUBMED 34737342 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1011) AUTHORS Kaiser,M., Wojahn,I., Rudat,C., Ludtke,T.H., Christoffels,V.M., Moon,A., Kispert,A. and Trowe,M.O. TITLE Regulation of otocyst patterning by Tbx2 and Tbx3 is required for inner ear morphogenesis in the mouse JOURNAL Development 148 (8) (2021) PUBMED 33795231 REFERENCE 3 (bases 1 to 1011) AUTHORS Westmoreland,J.J., Drosos,Y., Kelly,J., Ye,J., Means,A.L., Washington,M.K. and Sosa-Pineda,B. TITLE Dynamic distribution of claudin proteins in pancreatic epithelia undergoing morphogenesis or neoplastic transformation JOURNAL Dev Dyn 241 (3), 583-594 (2012) PUBMED 22275141 REFERENCE 4 (bases 1 to 1011) AUTHORS Lal-Nag,M. and Morin,P.J. TITLE The claudins JOURNAL Genome Biol 10 (8), 235 (2009) PUBMED 19706201 REMARK Review article REFERENCE 5 (bases 1 to 1011) AUTHORS Tsukita,S., Yamazaki,Y., Katsuno,T., Tamura,A. and Tsukita,S. TITLE Tight junction-based epithelial microenvironment and cell proliferation JOURNAL Oncogene 27 (55), 6930-6938 (2008) PUBMED 19029935 REMARK Review article REFERENCE 6 (bases 1 to 1011) AUTHORS Angelow,S., Ahlstrom,R. and Yu,A.S. TITLE Biology of claudins JOURNAL Am J Physiol Renal Physiol 295 (4), F867-F876 (2008) PUBMED 18480174 REMARK Review article REFERENCE 7 (bases 1 to 1011) AUTHORS Krause,G., Winkler,L., Mueller,S.L., Haseloff,R.F., Piontek,J. and Blasig,I.E. TITLE Structure and function of claudins JOURNAL Biochim Biophys Acta 1778 (3), 631-645 (2008) PUBMED 18036336 REMARK Review article COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC110509.21. On Sep 1, 2022 this sequence version replaced NM_029383.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is intronless and overlaps the 3' UTR of the Wwc2 gene (GeneID: 52357) on the opposite strand. [provided by RefSeq, Aug 2010]. ##Evidence-Data-START## Transcript is intronless :: AK008821.1, BY708720.1 [ECO:0000345] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1011 AC110509.21 81834-82844 c FEATURES Location/Qualifiers source 1..1011 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="8" /map="8 26.91 cM" gene 1..1011 /gene="Cldn22" /gene_synonym="2210404A22Rik; 5330431C14Rik; 9530051B05Rik" /note="claudin 22" /db_xref="GeneID:75677" /db_xref="MGI:MGI:1922927" exon 1..1011 /gene="Cldn22" /gene_synonym="2210404A22Rik; 5330431C14Rik; 9530051B05Rik" /inference="alignment:Splign:2.1.0" misc_feature 16..18 /gene="Cldn22" /gene_synonym="2210404A22Rik; 5330431C14Rik; 9530051B05Rik" /note="upstream in-frame stop codon" CDS 64..726 /gene="Cldn22" /gene_synonym="2210404A22Rik; 5330431C14Rik; 9530051B05Rik" /codon_start=1 /product="claudin-22" /protein_id="NP_083659.1" /db_xref="CCDS:CCDS52550.1" /db_xref="GeneID:75677" /db_xref="MGI:MGI:1922927" /translation="
MGLVFRTATQAAALLLSLLGWVLSCLTNYLPHWKNLNLELNEMENWTMGLWKSCVIQEEVGRQCKDFDSFLALPAELQVSRVLMSLCNGLGLLGLLASGCGLDCLRLGETQEGLKKRLLTLGGTLLWTSGVMVLVPVSWVAHKTVREFWDETMPEIVPRWEFGEALFLGWFAGFCLVLGGCVLHCAACWSPAPAASSHYAVAGPRDHQQHLELKQANPEI"
misc_feature 94..156 /gene="Cldn22" /gene_synonym="2210404A22Rik; 5330431C14Rik; 9530051B05Rik" /note="propagated from UniProtKB/Swiss-Prot (Q9D7U6.1); transmembrane region" misc_feature <208..612 /gene="Cldn22" /gene_synonym="2210404A22Rik; 5330431C14Rik; 9530051B05Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" misc_feature 307..369 /gene="Cldn22" /gene_synonym="2210404A22Rik; 5330431C14Rik; 9530051B05Rik" /note="propagated from UniProtKB/Swiss-Prot (Q9D7U6.1); transmembrane region" misc_feature 424..486 /gene="Cldn22" /gene_synonym="2210404A22Rik; 5330431C14Rik; 9530051B05Rik" /note="propagated from UniProtKB/Swiss-Prot (Q9D7U6.1); transmembrane region" misc_feature 556..618 /gene="Cldn22" /gene_synonym="2210404A22Rik; 5330431C14Rik; 9530051B05Rik" /note="propagated from UniProtKB/Swiss-Prot (Q9D7U6.1); transmembrane region" regulatory 992..997 /regulatory_class="polyA_signal_sequence" /gene="Cldn22" /gene_synonym="2210404A22Rik; 5330431C14Rik; 9530051B05Rik" /note="hexamer: AATAAA" polyA_site 1011 /gene="Cldn22" /gene_synonym="2210404A22Rik; 5330431C14Rik; 9530051B05Rik" /note="major polyA site" ORIGIN
acactttcttacagctaagcgtggggcaggagtcgggctggctcagcctcccagaacgttctaatgggcttagtcttccgaacggcaacgcaggcggctgcacttctgctctccctgctgggatgggttttatcctgccttacaaactacttgccgcactggaagaaccttaacttggagctgaacgagatggagaactggaccatggggctctggaaatcctgcgtcatccaggaggaagtcgggaggcaatgcaaggactttgactccttcctggccttgccagctgaactgcaggtctccagggtcttgatgtccctgtgcaacgggctggggctgctgggcttgctggcctctggctgtggcctggactgcttgaggcttggagagacacaggagggtctgaagaagcggctgctcaccctgggagggaccctgctctggacctcgggagtcatggtgctagttcctgtctcctgggtggcccacaagacggtgcgggagttctgggatgagaccatgcctgagattgtgcccaggtgggagtttggggaggccctgttcctgggctggtttgctggcttctgcctggtgctaggagggtgtgtgcttcactgtgcagcctgctggagcccggctcctgcagcctcgagtcactatgcagtggcgggacctcgagaccaccagcagcatctggagctgaagcaagccaatccagaaatctaagcccgggctcattggcgtctctaatctcactcagtcggacttggtaggctcccactttaatcacccctactgcctgcttctgactttctgaaatgcatacttccctcctgtggctgttatccgcctcagacacaagttctttctaccactgagtaaagcacttttgctttctatatggaggccaagtgggtgaggacctattgatggaatctgtctttactgtgcataaactaggctgcgactgtgcacacacagggcacctgtaaataaaacgtcatctgagca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]