GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-15 04:27:50, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_029383               1011 bp    mRNA    linear   ROD 13-JUN-2024
DEFINITION  Mus musculus claudin 22 (Cldn22), mRNA.
ACCESSION   NM_029383 XM_887785 XM_908254
VERSION     NM_029383.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1011)
  AUTHORS   Higashi,A.Y., Higashi,T., Furuse,K., Ozeki,K., Furuse,M. and
            Chiba,H.
  TITLE     Claudin-9 constitutes tight junctions of folliculo-stellate cells
            in the anterior pituitary gland
  JOURNAL   Sci Rep 11 (1), 21642 (2021)
   PUBMED   34737342
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1011)
  AUTHORS   Kaiser,M., Wojahn,I., Rudat,C., Ludtke,T.H., Christoffels,V.M.,
            Moon,A., Kispert,A. and Trowe,M.O.
  TITLE     Regulation of otocyst patterning by Tbx2 and Tbx3 is required for
            inner ear morphogenesis in the mouse
  JOURNAL   Development 148 (8) (2021)
   PUBMED   33795231
REFERENCE   3  (bases 1 to 1011)
  AUTHORS   Westmoreland,J.J., Drosos,Y., Kelly,J., Ye,J., Means,A.L.,
            Washington,M.K. and Sosa-Pineda,B.
  TITLE     Dynamic distribution of claudin proteins in pancreatic epithelia
            undergoing morphogenesis or neoplastic transformation
  JOURNAL   Dev Dyn 241 (3), 583-594 (2012)
   PUBMED   22275141
REFERENCE   4  (bases 1 to 1011)
  AUTHORS   Lal-Nag,M. and Morin,P.J.
  TITLE     The claudins
  JOURNAL   Genome Biol 10 (8), 235 (2009)
   PUBMED   19706201
  REMARK    Review article
REFERENCE   5  (bases 1 to 1011)
  AUTHORS   Tsukita,S., Yamazaki,Y., Katsuno,T., Tamura,A. and Tsukita,S.
  TITLE     Tight junction-based epithelial microenvironment and cell
            proliferation
  JOURNAL   Oncogene 27 (55), 6930-6938 (2008)
   PUBMED   19029935
  REMARK    Review article
REFERENCE   6  (bases 1 to 1011)
  AUTHORS   Angelow,S., Ahlstrom,R. and Yu,A.S.
  TITLE     Biology of claudins
  JOURNAL   Am J Physiol Renal Physiol 295 (4), F867-F876 (2008)
   PUBMED   18480174
  REMARK    Review article
REFERENCE   7  (bases 1 to 1011)
  AUTHORS   Krause,G., Winkler,L., Mueller,S.L., Haseloff,R.F., Piontek,J. and
            Blasig,I.E.
  TITLE     Structure and function of claudins
  JOURNAL   Biochim Biophys Acta 1778 (3), 631-645 (2008)
   PUBMED   18036336
  REMARK    Review article
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC110509.21.
            
            On Sep 1, 2022 this sequence version replaced NM_029383.1.
            
            Summary: This gene encodes a member of the claudin family. Claudins
            are integral membrane proteins and components of tight junction
            strands. Tight junction strands serve as a physical barrier to
            prevent solutes and water from passing freely through the
            paracellular space between epithelial or endothelial cell sheets,
            and also play critical roles in maintaining cell polarity and
            signal transductions. This gene is intronless and overlaps the 3'
            UTR of the Wwc2 gene (GeneID: 52357) on the opposite strand.
            [provided by RefSeq, Aug 2010].
            
            ##Evidence-Data-START##
            Transcript is intronless :: AK008821.1, BY708720.1 [ECO:0000345]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1011              AC110509.21        81834-82844         c
FEATURES             Location/Qualifiers
     source          1..1011
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="8"
                     /map="8 26.91 cM"
     gene            1..1011
                     /gene="Cldn22"
                     /gene_synonym="2210404A22Rik; 5330431C14Rik;
                     9530051B05Rik"
                     /note="claudin 22"
                     /db_xref="GeneID:75677"
                     /db_xref="MGI:MGI:1922927"
     exon            1..1011
                     /gene="Cldn22"
                     /gene_synonym="2210404A22Rik; 5330431C14Rik;
                     9530051B05Rik"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    16..18
                     /gene="Cldn22"
                     /gene_synonym="2210404A22Rik; 5330431C14Rik;
                     9530051B05Rik"
                     /note="upstream in-frame stop codon"
     CDS             64..726
                     /gene="Cldn22"
                     /gene_synonym="2210404A22Rik; 5330431C14Rik;
                     9530051B05Rik"
                     /codon_start=1
                     /product="claudin-22"
                     /protein_id="NP_083659.1"
                     /db_xref="CCDS:CCDS52550.1"
                     /db_xref="GeneID:75677"
                     /db_xref="MGI:MGI:1922927"
                     /translation="
MGLVFRTATQAAALLLSLLGWVLSCLTNYLPHWKNLNLELNEMENWTMGLWKSCVIQEEVGRQCKDFDSFLALPAELQVSRVLMSLCNGLGLLGLLASGCGLDCLRLGETQEGLKKRLLTLGGTLLWTSGVMVLVPVSWVAHKTVREFWDETMPEIVPRWEFGEALFLGWFAGFCLVLGGCVLHCAACWSPAPAASSHYAVAGPRDHQQHLELKQANPEI"
     misc_feature    94..156
                     /gene="Cldn22"
                     /gene_synonym="2210404A22Rik; 5330431C14Rik;
                     9530051B05Rik"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9D7U6.1);
                     transmembrane region"
     misc_feature    <208..612
                     /gene="Cldn22"
                     /gene_synonym="2210404A22Rik; 5330431C14Rik;
                     9530051B05Rik"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
     misc_feature    307..369
                     /gene="Cldn22"
                     /gene_synonym="2210404A22Rik; 5330431C14Rik;
                     9530051B05Rik"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9D7U6.1);
                     transmembrane region"
     misc_feature    424..486
                     /gene="Cldn22"
                     /gene_synonym="2210404A22Rik; 5330431C14Rik;
                     9530051B05Rik"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9D7U6.1);
                     transmembrane region"
     misc_feature    556..618
                     /gene="Cldn22"
                     /gene_synonym="2210404A22Rik; 5330431C14Rik;
                     9530051B05Rik"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9D7U6.1);
                     transmembrane region"
     regulatory      992..997
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Cldn22"
                     /gene_synonym="2210404A22Rik; 5330431C14Rik;
                     9530051B05Rik"
                     /note="hexamer: AATAAA"
     polyA_site      1011
                     /gene="Cldn22"
                     /gene_synonym="2210404A22Rik; 5330431C14Rik;
                     9530051B05Rik"
                     /note="major polyA site"
ORIGIN      
acactttcttacagctaagcgtggggcaggagtcgggctggctcagcctcccagaacgttctaatgggcttagtcttccgaacggcaacgcaggcggctgcacttctgctctccctgctgggatgggttttatcctgccttacaaactacttgccgcactggaagaaccttaacttggagctgaacgagatggagaactggaccatggggctctggaaatcctgcgtcatccaggaggaagtcgggaggcaatgcaaggactttgactccttcctggccttgccagctgaactgcaggtctccagggtcttgatgtccctgtgcaacgggctggggctgctgggcttgctggcctctggctgtggcctggactgcttgaggcttggagagacacaggagggtctgaagaagcggctgctcaccctgggagggaccctgctctggacctcgggagtcatggtgctagttcctgtctcctgggtggcccacaagacggtgcgggagttctgggatgagaccatgcctgagattgtgcccaggtgggagtttggggaggccctgttcctgggctggtttgctggcttctgcctggtgctaggagggtgtgtgcttcactgtgcagcctgctggagcccggctcctgcagcctcgagtcactatgcagtggcgggacctcgagaccaccagcagcatctggagctgaagcaagccaatccagaaatctaagcccgggctcattggcgtctctaatctcactcagtcggacttggtaggctcccactttaatcacccctactgcctgcttctgactttctgaaatgcatacttccctcctgtggctgttatccgcctcagacacaagttctttctaccactgagtaaagcacttttgctttctatatggaggccaagtgggtgaggacctattgatggaatctgtctttactgtgcataaactaggctgcgactgtgcacacacagggcacctgtaaataaaacgtcatctgagca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]