2024-09-28 09:31:13, GGRNA.v2 : RefSeq release 225 (Jul, 2024)
LOCUS NM_029203 783 bp mRNA linear ROD 04-AUG-2023 DEFINITION Mus musculus reproductive homeobox 2A (Rhox2a), transcript variant 1, mRNA. ACCESSION NM_029203 XM_918639 VERSION NM_029203.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 783) AUTHORS Branco MR, King M, Perez-Garcia V, Bogutz AB, Caley M, Fineberg E, Lefebvre L, Cook SJ, Dean W, Hemberger M and Reik W. TITLE Maternal DNA Methylation Regulates Early Trophoblast Development JOURNAL Dev Cell 36 (2), 152-163 (2016) PUBMED 26812015 REFERENCE 2 (bases 1 to 783) AUTHORS Daggag H, Svingen T, Western PS, van den Bergen JA, McClive PJ, Harley VR, Koopman P and Sinclair AH. TITLE The rhox homeobox gene family shows sexually dimorphic and dynamic expression during mouse embryonic gonad development JOURNAL Biol Reprod 79 (3), 468-474 (2008) PUBMED 18562707 REFERENCE 3 (bases 1 to 783) AUTHORS Hu Z, Shanker S, MacLean JA 2nd, Ackerman SL and Wilkinson MF. TITLE The RHOX5 homeodomain protein mediates transcriptional repression of the netrin-1 receptor gene Unc5c JOURNAL J Biol Chem 283 (7), 3866-3876 (2008) PUBMED 18077458 REFERENCE 4 (bases 1 to 783) AUTHORS Oda M, Yamagiwa A, Yamamoto S, Nakayama T, Tsumura A, Sasaki H, Nakao K, Li E and Okano M. TITLE DNA methylation regulates long-range gene silencing of an X-linked homeobox gene cluster in a lineage-specific manner JOURNAL Genes Dev 20 (24), 3382-3394 (2006) PUBMED 17182866 REFERENCE 5 (bases 1 to 783) AUTHORS MacLean,J.A. 2nd, Lorenzetti,D., Hu,Z., Salerno,W.J., Miller,J. and Wilkinson,M.F. TITLE Rhox homeobox gene cluster: recent duplication of three family members JOURNAL Genesis 44 (3), 122-129 (2006) PUBMED 16496311 REFERENCE 6 (bases 1 to 783) AUTHORS Morris L, Gordon J and Blackburn CC. TITLE Identification of a tandem duplicated array in the Rhox alpha locus on mouse chromosome X JOURNAL Mamm Genome 17 (2), 178-187 (2006) PUBMED 16465597 REFERENCE 7 (bases 1 to 783) AUTHORS Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML, Macleod C and Wilkinson MF. TITLE Rhox: a new homeobox gene cluster JOURNAL Cell 120 (3), 369-382 (2005) PUBMED 15707895 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK015997.1 and BX637526.1. On Apr 8, 2006 this sequence version replaced NM_029203.1. Transcript Variant: This variant (1) represents the shorter transcript and encodes the longer protein (isoform 1). ##Evidence-Data-START## Transcript exon combination :: AK015997.1, DQ058639.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849384, SAMN01164134 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on expression, longest protein ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-779 AK015997.1 2-780 780-783 BX637526.1 4-7 c FEATURES Location/Qualifiers source 1..783 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="X" /map="X 21.67 cM" gene 1..783 /gene="Rhox2a" /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1" /note="reproductive homeobox 2A" /db_xref="GeneID:75199" /db_xref="MGI:MGI:1922449" exon 1..95 /gene="Rhox2a" /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1" /inference="alignment:Splign:2.1.0" CDS 29..604 /gene="Rhox2a" /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1" /note="isoform 1 is encoded by transcript variant 1; reproductive homeobox on X chromosome, 2" /codon_start=1 /product="reproductive homeobox 2A isoform 1" /protein_id="NP_083479.1" /db_xref="CCDS:CCDS30075.1" /db_xref="GeneID:75199" /db_xref="MGI:MGI:1922449" /translation="
MERQSVNYKLDVGPEEDEENANGVKTLMVLLAGEGRNEGESGRGLPGSGASAAEGYRAGEISAGGPAAPVADLMDNSNQEDLGATGCDQEKEKQPEEPVPDSMGDLENVKRVSGPWSTVNPVRVLVPEFRHGWQQSFNVLQLQELESIFQCNHYISTKEANRLARSMGVSEATVQEWFLKRREKYRSYKRL"
misc_feature 428..586 /gene="Rhox2a" /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:238039" misc_feature order(434..436,554..556,563..568,575..577) /gene="Rhox2a" /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 96..507 /gene="Rhox2a" /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1" /inference="alignment:Splign:2.1.0" exon 508..553 /gene="Rhox2a" /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1" /inference="alignment:Splign:2.1.0" exon 554..783 /gene="Rhox2a" /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1" /inference="alignment:Splign:2.1.0" regulatory 763..768 /regulatory_class="polyA_signal_sequence" /gene="Rhox2a" /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1" /note="putative" polyA_site 779 /gene="Rhox2a" /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1" /note="putative" ORIGIN
gaataaggacttccacggctttacagacatggagcgacaaagcgtcaattacaagcttgatgtgggacctgaggaggatgaggaaaatgcgaatggtgtaaagactctgatggtcttgctggctggagagggaagaaatgagggagagagtggacggggcctgcctgggtcgggagcctcagcagcggaaggatacagagcaggagaaataagtgcaggtgggcctgctgcgccagtagccgacctcatggataacagcaaccaagaggaccttggtgccactggctgtgaccaggagaaggagaagcagccagaggagccagtccctgattccatgggagatttggaaaatgtaaagcgtgtgtccgggccgtggtccactgttaatcctgtgagagtgttggtgcccgaattccgccacggttggcaacagagcttcaatgtgctgcaactacaagagctggagagcatcttccagtgcaatcactacatcagcactaaggaggcaaatcgcctggcaagatccatgggagtgagtgaagccacagtgcaggaatggtttttgaagaggagagagaaatacaggagttataagaggctgtaaaggctcagaggtcctcttcctgcattccggagcatctctctgtgaaggctgtggagaagccccaggcagccacccatgctcaagtcactgtagacagacgatgttgtgccgccaaagccctgttacaacacagttatctcctcaatacttgtatttgcaataaagagctgaattctcaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]