GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-09-28 09:31:13, GGRNA.v2 : RefSeq release 225 (Jul, 2024)

LOCUS       NM_029203                783 bp    mRNA    linear   ROD 04-AUG-2023
DEFINITION  Mus musculus reproductive homeobox 2A (Rhox2a), transcript variant
            1, mRNA.
ACCESSION   NM_029203 XM_918639
VERSION     NM_029203.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 783)
  AUTHORS   Branco MR, King M, Perez-Garcia V, Bogutz AB, Caley M, Fineberg E,
            Lefebvre L, Cook SJ, Dean W, Hemberger M and Reik W.
  TITLE     Maternal DNA Methylation Regulates Early Trophoblast Development
  JOURNAL   Dev Cell 36 (2), 152-163 (2016)
   PUBMED   26812015
REFERENCE   2  (bases 1 to 783)
  AUTHORS   Daggag H, Svingen T, Western PS, van den Bergen JA, McClive PJ,
            Harley VR, Koopman P and Sinclair AH.
  TITLE     The rhox homeobox gene family shows sexually dimorphic and dynamic
            expression during mouse embryonic gonad development
  JOURNAL   Biol Reprod 79 (3), 468-474 (2008)
   PUBMED   18562707
REFERENCE   3  (bases 1 to 783)
  AUTHORS   Hu Z, Shanker S, MacLean JA 2nd, Ackerman SL and Wilkinson MF.
  TITLE     The RHOX5 homeodomain protein mediates transcriptional repression
            of the netrin-1 receptor gene Unc5c
  JOURNAL   J Biol Chem 283 (7), 3866-3876 (2008)
   PUBMED   18077458
REFERENCE   4  (bases 1 to 783)
  AUTHORS   Oda M, Yamagiwa A, Yamamoto S, Nakayama T, Tsumura A, Sasaki H,
            Nakao K, Li E and Okano M.
  TITLE     DNA methylation regulates long-range gene silencing of an X-linked
            homeobox gene cluster in a lineage-specific manner
  JOURNAL   Genes Dev 20 (24), 3382-3394 (2006)
   PUBMED   17182866
REFERENCE   5  (bases 1 to 783)
  AUTHORS   MacLean,J.A. 2nd, Lorenzetti,D., Hu,Z., Salerno,W.J., Miller,J. and
            Wilkinson,M.F.
  TITLE     Rhox homeobox gene cluster: recent duplication of three family
            members
  JOURNAL   Genesis 44 (3), 122-129 (2006)
   PUBMED   16496311
REFERENCE   6  (bases 1 to 783)
  AUTHORS   Morris L, Gordon J and Blackburn CC.
  TITLE     Identification of a tandem duplicated array in the Rhox alpha locus
            on mouse chromosome X
  JOURNAL   Mamm Genome 17 (2), 178-187 (2006)
   PUBMED   16465597
REFERENCE   7  (bases 1 to 783)
  AUTHORS   Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML,
            Macleod C and Wilkinson MF.
  TITLE     Rhox: a new homeobox gene cluster
  JOURNAL   Cell 120 (3), 369-382 (2005)
   PUBMED   15707895
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AK015997.1 and BX637526.1.
            
            On Apr 8, 2006 this sequence version replaced NM_029203.1.
            
            Transcript Variant: This variant (1) represents the shorter
            transcript and encodes the longer protein (isoform 1).
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK015997.1, DQ058639.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849384, SAMN01164134
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on expression, longest protein
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-779               AK015997.1         2-780
            780-783             BX637526.1         4-7                 c
FEATURES             Location/Qualifiers
     source          1..783
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="X"
                     /map="X 21.67 cM"
     gene            1..783
                     /gene="Rhox2a"
                     /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1"
                     /note="reproductive homeobox 2A"
                     /db_xref="GeneID:75199"
                     /db_xref="MGI:MGI:1922449"
     exon            1..95
                     /gene="Rhox2a"
                     /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1"
                     /inference="alignment:Splign:2.1.0"
     CDS             29..604
                     /gene="Rhox2a"
                     /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1"
                     /note="isoform 1 is encoded by transcript variant 1;
                     reproductive homeobox on X chromosome, 2"
                     /codon_start=1
                     /product="reproductive homeobox 2A isoform 1"
                     /protein_id="NP_083479.1"
                     /db_xref="CCDS:CCDS30075.1"
                     /db_xref="GeneID:75199"
                     /db_xref="MGI:MGI:1922449"
                     /translation="
MERQSVNYKLDVGPEEDEENANGVKTLMVLLAGEGRNEGESGRGLPGSGASAAEGYRAGEISAGGPAAPVADLMDNSNQEDLGATGCDQEKEKQPEEPVPDSMGDLENVKRVSGPWSTVNPVRVLVPEFRHGWQQSFNVLQLQELESIFQCNHYISTKEANRLARSMGVSEATVQEWFLKRREKYRSYKRL"
     misc_feature    428..586
                     /gene="Rhox2a"
                     /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1"
                     /note="Homeodomain; DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:238039"
     misc_feature    order(434..436,554..556,563..568,575..577)
                     /gene="Rhox2a"
                     /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            96..507
                     /gene="Rhox2a"
                     /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1"
                     /inference="alignment:Splign:2.1.0"
     exon            508..553
                     /gene="Rhox2a"
                     /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1"
                     /inference="alignment:Splign:2.1.0"
     exon            554..783
                     /gene="Rhox2a"
                     /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1"
                     /inference="alignment:Splign:2.1.0"
     regulatory      763..768
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Rhox2a"
                     /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1"
                     /note="putative"
     polyA_site      779
                     /gene="Rhox2a"
                     /gene_synonym="4930539I12Rik; Rhox2; Rhox2.1"
                     /note="putative"
ORIGIN      
gaataaggacttccacggctttacagacatggagcgacaaagcgtcaattacaagcttgatgtgggacctgaggaggatgaggaaaatgcgaatggtgtaaagactctgatggtcttgctggctggagagggaagaaatgagggagagagtggacggggcctgcctgggtcgggagcctcagcagcggaaggatacagagcaggagaaataagtgcaggtgggcctgctgcgccagtagccgacctcatggataacagcaaccaagaggaccttggtgccactggctgtgaccaggagaaggagaagcagccagaggagccagtccctgattccatgggagatttggaaaatgtaaagcgtgtgtccgggccgtggtccactgttaatcctgtgagagtgttggtgcccgaattccgccacggttggcaacagagcttcaatgtgctgcaactacaagagctggagagcatcttccagtgcaatcactacatcagcactaaggaggcaaatcgcctggcaagatccatgggagtgagtgaagccacagtgcaggaatggtttttgaagaggagagagaaatacaggagttataagaggctgtaaaggctcagaggtcctcttcctgcattccggagcatctctctgtgaaggctgtggagaagccccaggcagccacccatgctcaagtcactgtagacagacgatgttgtgccgccaaagccctgttacaacacagttatctcctcaatacttgtatttgcaataaagagctgaattctcaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]