GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-08-17 09:33:16, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_023894                898 bp    mRNA    linear   ROD 04-AUG-2023
DEFINITION  Mus musculus reproductive homeobox 9 (Rhox9), mRNA.
ACCESSION   NM_023894
VERSION     NM_023894.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 898)
  AUTHORS   Thompson CL, Ng L, Menon V, Martinez S, Lee CK, Glattfelder K,
            Sunkin SM, Henry A, Lau C, Dang C, Garcia-Lopez R, Martinez-Ferre
            A, Pombero A, Rubenstein JLR, Wakeman WB, Hohmann J, Dee N, Sodt
            AJ, Young R, Smith K, Nguyen TN, Kidney J, Kuan L, Jeromin A,
            Kaykas A, Miller J, Page D, Orta G, Bernard A, Riley Z, Smith S,
            Wohnoutka P, Hawrylycz MJ, Puelles L and Jones AR.
  TITLE     A high-resolution spatiotemporal atlas of gene expression of the
            developing mouse brain
  JOURNAL   Neuron 83 (2), 309-323 (2014)
   PUBMED   24952961
REFERENCE   2  (bases 1 to 898)
  AUTHORS   Wang Q, Liu X, Tang N, Archambeault DR, Li J, Song H, Tang C, He B,
            Matzuk MM and Wang Y.
  TITLE     GASZ promotes germ cell derivation from embryonic stem cells
  JOURNAL   Stem Cell Res 11 (2), 845-860 (2013)
   PUBMED   23816659
REFERENCE   3  (bases 1 to 898)
  AUTHORS   Berletch JB, Deng X, Nguyen DK and Disteche CM.
  TITLE     Female bias in Rhox6 and 9 regulation by the histone demethylase
            KDM6A
  JOURNAL   PLoS Genet 9 (5), e1003489 (2013)
   PUBMED   23658530
  REMARK    GeneRIF: We report that two members of the Rhox cluster, Rhox6 and
            9, are regulated by de-methylation of histone H3 at lysine 27 by
            KDM6A
REFERENCE   4  (bases 1 to 898)
  AUTHORS   Guo G, Huss M, Tong GQ, Wang C, Li Sun L, Clarke ND and Robson P.
  TITLE     Resolution of cell fate decisions revealed by single-cell gene
            expression analysis from zygote to blastocyst
  JOURNAL   Dev Cell 18 (4), 675-685 (2010)
   PUBMED   20412781
REFERENCE   5  (bases 1 to 898)
  AUTHORS   Daggag H, Svingen T, Western PS, van den Bergen JA, McClive PJ,
            Harley VR, Koopman P and Sinclair AH.
  TITLE     The rhox homeobox gene family shows sexually dimorphic and dynamic
            expression during mouse embryonic gonad development
  JOURNAL   Biol Reprod 79 (3), 468-474 (2008)
   PUBMED   18562707
REFERENCE   6  (bases 1 to 898)
  AUTHORS   Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML,
            Macleod C and Wilkinson MF.
  TITLE     Rhox: a new homeobox gene cluster
  JOURNAL   Cell 120 (3), 369-382 (2005)
   PUBMED   15707895
REFERENCE   7  (bases 1 to 898)
  AUTHORS   Small CL, Shima JE, Uzumcu M, Skinner MK and Griswold MD.
  TITLE     Profiling gene expression during the differentiation and
            development of the murine embryonic gonad
  JOURNAL   Biol Reprod 72 (2), 492-501 (2005)
   PUBMED   15496517
REFERENCE   8  (bases 1 to 898)
  AUTHORS   Takasaki N, Rankin T and Dean J.
  TITLE     Normal gonadal development in mice lacking GPBOX, a homeobox
            protein expressed in germ cells at the onset of sexual dimorphism
  JOURNAL   Mol Cell Biol 21 (23), 8197-8202 (2001)
   PUBMED   11689708
REFERENCE   9  (bases 1 to 898)
  AUTHORS   Takasaki N, McIsaac R and Dean J.
  TITLE     Gpbox (Psx2), a homeobox gene preferentially expressed in female
            germ cells at the onset of sexual dimorphism in mice
  JOURNAL   Dev Biol 223 (1), 181-193 (2000)
   PUBMED   10864470
REFERENCE   10 (bases 1 to 898)
  AUTHORS   Han YJ, Lee YH and Chun JY.
  TITLE     Identification and characterization of Psx-2, a novel member of the
            Psx (placenta-specific homeobox) family
  JOURNAL   Gene 241 (1), 149-155 (2000)
   PUBMED   10607909
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AF201698.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF201698.1, CK022884.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN01164131, SAMN01164134
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..898
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10090"
                     /chromosome="X"
                     /map="X 22.15 cM"
     gene            1..898
                     /gene="Rhox9"
                     /gene_synonym="1600026O01Rik; Gpbox; Psx2"
                     /note="reproductive homeobox 9"
                     /db_xref="GeneID:104384"
                     /db_xref="MGI:MGI:1890128"
     exon            1..173
                     /gene="Rhox9"
                     /gene_synonym="1600026O01Rik; Gpbox; Psx2"
                     /inference="alignment:Splign:2.1.0"
     CDS             92..775
                     /gene="Rhox9"
                     /gene_synonym="1600026O01Rik; Gpbox; Psx2"
                     /note="placenta specific homeobox 2; trophoblast-specific
                     homeobox protein PSX2"
                     /codon_start=1
                     /product="reproductive homeobox on X chromosome, 9"
                     /protein_id="NP_076383.1"
                     /db_xref="CCDS:CCDS30083.1"
                     /db_xref="GeneID:104384"
                     /db_xref="MGI:MGI:1890128"
                     /translation="
METPQDSRQSIQKPPSPGAEEDKEEQHGGNAVVSGAGEEGIDKKELVMSGLAQGGLDQGEGAQGEVAGGEQAQEEPAPLSPAQEATGGEEEGENKEGEMEGRHAGDGASGPEDDNIQEEGGENIDQQPPQQEAAIPEGMRNPQAGNYLAHQRTRRTRFTHSQLRDLERLFQENRFPSLRVRRDLARWMGVDESDVQEWFKMRRALFRRHSRLMMFCELPPITENNSP"
     misc_feature    545..715
                     /gene="Rhox9"
                     /gene_synonym="1600026O01Rik; Gpbox; Psx2"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            174..633
                     /gene="Rhox9"
                     /gene_synonym="1600026O01Rik; Gpbox; Psx2"
                     /inference="alignment:Splign:2.1.0"
     exon            634..679
                     /gene="Rhox9"
                     /gene_synonym="1600026O01Rik; Gpbox; Psx2"
                     /inference="alignment:Splign:2.1.0"
     exon            680..882
                     /gene="Rhox9"
                     /gene_synonym="1600026O01Rik; Gpbox; Psx2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
agcagagagatatatattcaggctccggaactgtgaggacacagcgttggaagcctcttcgggagcagcgtcggatccagagattctcgctatggagactcctcaagacagccgccaaagcatccaaaagcctccgagtccgggagccgaggaggacaaggaagaacagcatggtgggaatgcagtggtctccggggctggagaggaaggaatagacaagaaagagcttgttatgagcgggcttgctcagggtgggcttgatcagggcgaaggcgctcagggcgaggttgctggaggtgagcaggctcaagaagagcctgctccattgagtccagctcaggaagccactggaggagaagaggagggagaaaacaaggaaggagaaatggaaggaagacatgctggtgatggtgcttctggccccgaggatgacaacatccaggaagaaggcggcgaaaacatagatcaacaaccgccgcaacaagaggcagccattcctgagggcatgagaaatccacaggctgggaactatctggctcaccagcggacccgccgcaccaggttcacccactctcagctgcgtgatctggagcgccttttccaagagaatcgcttccccagcttgcgagtaaggagggatcttgcacgatggatgggtgtggatgaatctgatgtgcaggagtggtttaagatgaggagagcccttttccgcagacacagcaggctgatgatgttctgcgaactgccaccgattacagagaacaactctccctgaagattttggagcagcacttgagtgcctcccctgtcgtggagccatgatggccaggacaacctttacttctctataattatttcaacaataaagatgagcattctgaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]