2024-09-28 09:29:00, GGRNA.v2 : RefSeq release 225 (Jul, 2024)
LOCUS NM_021300 886 bp mRNA linear ROD 04-AUG-2023 DEFINITION Mus musculus reproductive homeobox 4B (Rhox4b), mRNA. ACCESSION NM_021300 XM_918433 VERSION NM_021300.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 886) AUTHORS Beal R, Alonso-Carriazo Fernandez A, Grammatopoulos DK, Matter K and Balda MS. TITLE ARHGEF18/p114RhoGEF Coordinates PKA/CREB Signaling and Actomyosin Remodeling to Promote Trophoblast Cell-Cell Fusion During Placenta Morphogenesis JOURNAL Front Cell Dev Biol 9, 658006 (2021) PUBMED 33842485 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 886) AUTHORS Langford MB, Outhwaite JE, Hughes M, Natale DRC and Simmons DG. TITLE Deletion of the Syncytin A receptor Ly6e impairs syncytiotrophoblast fusion and placental morphogenesis causing embryonic lethality in mice JOURNAL Sci Rep 8 (1), 3961 (2018) PUBMED 29500366 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 886) AUTHORS Funato N, Kokubo H, Nakamura M, Yanagisawa H and Saga Y. TITLE Specification of jaw identity by the Hand2 transcription factor JOURNAL Sci Rep 6, 28405 (2016) PUBMED 27329940 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 886) AUTHORS Thompson CL, Ng L, Menon V, Martinez S, Lee CK, Glattfelder K, Sunkin SM, Henry A, Lau C, Dang C, Garcia-Lopez R, Martinez-Ferre A, Pombero A, Rubenstein JLR, Wakeman WB, Hohmann J, Dee N, Sodt AJ, Young R, Smith K, Nguyen TN, Kidney J, Kuan L, Jeromin A, Kaykas A, Miller J, Page D, Orta G, Bernard A, Riley Z, Smith S, Wohnoutka P, Hawrylycz MJ, Puelles L and Jones AR. TITLE A high-resolution spatiotemporal atlas of gene expression of the developing mouse brain JOURNAL Neuron 83 (2), 309-323 (2014) PUBMED 24952961 REFERENCE 5 (bases 1 to 886) AUTHORS Wiese CB, Ireland S, Fleming NL, Yu J, Valerius MT, Georgas K, Chiu HS, Brennan J, Armstrong J, Little MH, McMahon AP and Southard-Smith EM. TITLE A genome-wide screen to identify transcription factors expressed in pelvic Ganglia of the lower urinary tract JOURNAL Front Neurosci 6, 130 (2012) PUBMED 22988430 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 886) AUTHORS Lee WK, Kim YM, Malik N, Ma C and Westphal H. TITLE Cloning and characterization of the 5'-flanking region of the Ehox gene JOURNAL Biochem Biophys Res Commun 341 (1), 225-231 (2006) PUBMED 16414020 REMARK GeneRIF: These results suggest that NFY is an essential regulatory factor for Ehox transcriptional activity, which is important for the post-implantation stage of the developing embryo. REFERENCE 7 (bases 1 to 886) AUTHORS Morris L, Gordon J and Blackburn CC. TITLE Identification of a tandem duplicated array in the Rhox alpha locus on mouse chromosome X JOURNAL Mamm Genome 17 (2), 178-187 (2006) PUBMED 16465597 REFERENCE 8 (bases 1 to 886) AUTHORS Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML, Macleod C and Wilkinson MF. TITLE Rhox: a new homeobox gene cluster JOURNAL Cell 120 (3), 369-382 (2005) PUBMED 15707895 REFERENCE 9 (bases 1 to 886) AUTHORS Jackson M, Baird JW, Nichols J, Wilkie R, Ansell JD, Graham G and Forrester LM. TITLE Expression of a novel homeobox gene Ehox in trophoblast stem cells and pharyngeal pouch endoderm JOURNAL Dev Dyn 228 (4), 740-744 (2003) PUBMED 14648851 REMARK GeneRIF: Ehox is expressed in trophoblast stem cells and pharyngeal pouch endoderm REFERENCE 10 (bases 1 to 886) AUTHORS Jackson M, Baird JW, Cambray N, Ansell JD, Forrester LM and Graham GJ. TITLE Cloning and characterization of Ehox, a novel homeobox gene essential for embryonic stem cell differentiation JOURNAL J Biol Chem 277 (41), 38683-38692 (2002) PUBMED 12087094 REMARK GeneRIF: Results suggest that Ehox is a novel homeobox-containing gene that is essential for the earliest stages of murine ES cell differentiation. COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AJ972666.1. On Mar 7, 2006 this sequence version replaced NM_021300.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AJ972666.1, AF265350.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN01164134, SAMN01164137 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. FEATURES Location/Qualifiers source 1..886 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="X" /map="X 21.73 cM" gene 1..886 /gene="Rhox4b" /gene_synonym="5430432L21Rik; Ehox; Rhox4.2; Rhox4a" /note="reproductive homeobox 4B" /db_xref="GeneID:57737" /db_xref="MGI:MGI:1930129" exon 1..198 /gene="Rhox4b" /gene_synonym="5430432L21Rik; Ehox; Rhox4.2; Rhox4a" /inference="alignment:Splign:2.1.0" CDS 132..749 /gene="Rhox4b" /gene_synonym="5430432L21Rik; Ehox; Rhox4.2; Rhox4a" /note="ES cell derived homeobox containing; reproductive homeobox on X chromosome 4; homeobox protein EHOX" /codon_start=1 /product="reproductive homeobox 4B" /protein_id="NP_067275.1" /db_xref="CCDS:CCDS30077.1" /db_xref="GeneID:57737" /db_xref="MGI:MGI:1930129" /translation="
MEHQNTNYLLHEGLGKDKEKLNGGKTQTVLPLDGEGRNEGESVLGQSGAAAVEWDKAEELSGEGGPAAGDADLMDNSNQEDQDTSGSAQEEEKLPEEPVLRDAVVIDKVQPIPVLVSGVRPKSVWVQQRSLHYNFQWWQLQELERIFQQNHFIRAEERRHLARWIGVSEARVMTWFKKRREHFRRGQSQLGMNDDAPVGSHSTFL"
misc_feature 516..692 /gene="Rhox4b" /gene_synonym="5430432L21Rik; Ehox; Rhox4.2; Rhox4a" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:238039" misc_feature order(516..530,534..536,585..587,603..605,642..644, 648..653,660..665,669..677,681..686) /gene="Rhox4b" /gene_synonym="5430432L21Rik; Ehox; Rhox4.2; Rhox4a" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(522..524,531..533,651..653,660..665,672..674) /gene="Rhox4b" /gene_synonym="5430432L21Rik; Ehox; Rhox4.2; Rhox4a" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 199..604 /gene="Rhox4b" /gene_synonym="5430432L21Rik; Ehox; Rhox4.2; Rhox4a" /inference="alignment:Splign:2.1.0" exon 605..650 /gene="Rhox4b" /gene_synonym="5430432L21Rik; Ehox; Rhox4.2; Rhox4a" /inference="alignment:Splign:2.1.0" exon 651..886 /gene="Rhox4b" /gene_synonym="5430432L21Rik; Ehox; Rhox4.2; Rhox4a" /inference="alignment:Splign:2.1.0" ORIGIN
ggctttcagctttcggctttcggctttcagctttcggctgtcggctgtcggctttcagctttcggttttcacaacctcaggaactccgactcagaatctgctggggaaagctgcagggaagcactcaggacatggagcatcaaaacaccaactacctacttcatgagggacttggcaaggacaaggaaaagttgaatggtgggaagacacagacagtcttaccactggatggagagggaagaaatgagggagagagtgtactgggccagtccggagccgcagcagtggaatgggacaaagcagaagaattaagtggagaaggtgggcctgctgctggtgatgcagacctcatggataacagcaaccaagaggaccaggacaccagtggcagtgcccaggaggaggagaagctgccagaggagccagttctcagggatgctgtggtcatagacaaagtgcagcctattccagtgctggtatctggtgtgcggcctaagtcagtgtgggtacagcagcgtagcttacactacaatttccaatggtggcagctgcaggagctggagcgcattttccagcagaatcacttcatccgtgcagaggaaagaagacatctggcaagatggataggtgtgagtgaagccagagttatgacatggtttaagaagaggagagagcacttcagaagaggacaaagtcagttaggaatgaatgatgatgcccctgtggggtcccactctacctttctctgaagatggcacaggaggcctggtgtaccacccttgaccaggagccacgtgcagacccctgctgccttccaccagcatgttattgcatctctattccctaagcatttgtatgtgaaataaatagattctcagtttctttg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]