2025-03-13 04:37:40, GGRNA.v2 : RefSeq release 228 (Jan, 2025)
LOCUS NM_013805 1420 bp mRNA linear ROD 31-DEC-2024 DEFINITION Mus musculus claudin 5 (Cldn5), mRNA. ACCESSION NM_013805 VERSION NM_013805.4 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1420) AUTHORS Siegerist,F., Kliewe,F., Hammer,E., Schakau,P., Chi Soh,J.E., Weber,C., Lindenmeyer,M., Reichelt-Wurm,S., Drenic,V., Chatziantoniou,C., Chadjichristos,C.E., Zhang,Y., Simm,S., Banas,M.C., Nauck,M., Volker,U. and Endlich,N. TITLE The role of the tricellular junction protein ILDR2 in glomerulopathies: Expression patterns and functional insights JOURNAL iScience 27 (12), 111329 (2024) PUBMED 39640577 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1420) AUTHORS Carus-Cadavieco,M., Gonzalez de la Fuente,S., Berenguer Lopez,I., Serrano-Lope,M.A., Aguado,B., Guix,F., Palomer,E. and Dotti,C.G. TITLE Loss of Cldn5 -and increase in Irf7-in the hippocampus and cerebral cortex of diabetic mice at the early symptomatic stage JOURNAL Nutr Diabetes 14 (1), 64 (2024) PUBMED 39147772 REMARK GeneRIF: Loss of Cldn5 -and increase in Irf7-in the hippocampus and cerebral cortex of diabetic mice at the early symptomatic stage. Publication Status: Online-Only REFERENCE 3 (bases 1 to 1420) AUTHORS Zhang,Y., Chen,B., Wang,M., Liu,H., Chen,M., Zhu,J., Zhang,Y., Wang,X., Wu,Y., Liu,D., Cui,G., Kitakaze,M., Kim,J.K., Wang,Y. and Luo,T. TITLE A novel function of claudin-5 in maintaining the structural integrity of the heart and its implications in cardiac pathology JOURNAL Biochim Biophys Acta Mol Basis Dis 1870 (6), 167274 (2024) PUBMED 38838411 REMARK GeneRIF: A novel function of claudin-5 in maintaining the structural integrity of the heart and its implications in cardiac pathology. REFERENCE 4 (bases 1 to 1420) AUTHORS Yuki,K., Vallon,M., Ding,J., Rada,C.C., Tang,A.T., Vilches-Moure,J.G., McCormick,A.K., Henao Echeverri,M.F., Alwahabi,S., Braunger,B.M., Ergun,S., Kahn,M.L. and Kuo,C.J. TITLE GPR124 regulates murine brain embryonic angiogenesis and BBB formation by an intracellular domain-independent mechanism JOURNAL Development 151 (11) (2024) PUBMED 38682276 REFERENCE 5 (bases 1 to 1420) AUTHORS Vazquez-Liebanas,E., Mocci,G., Li,W., Lavina,B., Reddy,A., O'Connor,C., Hudson,N., Elbeck,Z., Nikoloudis,I., Gaengel,K., Vanlandewijck,M., Campbell,M., Betsholtz,C. and Mae,M.A. TITLE Mosaic deletion of claudin-5 reveals rapid non-cell-autonomous consequences of blood-brain barrier leakage JOURNAL Cell Rep 43 (3), 113911 (2024) PUBMED 38446668 REMARK GeneRIF: Mosaic deletion of claudin-5 reveals rapid non-cell-autonomous consequences of blood-brain barrier leakage. REFERENCE 6 (bases 1 to 1420) AUTHORS Citi,S. and Cordenonsi,M. TITLE Tight junction proteins JOURNAL Biochim Biophys Acta 1448 (1), 1-11 (1998) PUBMED 9824655 REMARK Review article REFERENCE 7 (bases 1 to 1420) AUTHORS Sutherland,H.F., Kim,U.J. and Scambler,P.J. TITLE Cloning and comparative mapping of the DiGeorge syndrome critical region in the mouse JOURNAL Genomics 52 (1), 37-43 (1998) PUBMED 9740669 REFERENCE 8 (bases 1 to 1420) AUTHORS Chen,Z., Zandonatti,M., Jakubowski,D. and Fox,H.S. TITLE Brain capillary endothelial cells express MBEC1, a protein that is related to the Clostridium perfringens enterotoxin receptors JOURNAL Lab Invest 78 (3), 353-363 (1998) PUBMED 9520948 REFERENCE 9 (bases 1 to 1420) AUTHORS Puech,A., Saint-Jore,B., Funke,B., Gilbert,D.J., Sirotkin,H., Copeland,N.G., Jenkins,N.A., Kucherlapati,R., Morrow,B. and Skoultchi,A.I. TITLE Comparative mapping of the human 22q11 chromosomal region and the orthologous region in mice reveals complex changes in gene organization JOURNAL Proc Natl Acad Sci U S A 94 (26), 14608-14613 (1997) PUBMED 9405660 REFERENCE 10 (bases 1 to 1420) AUTHORS Sirotkin,H., Morrow,B., Saint-Jore,B., Puech,A., Das Gupta,R., Patanjali,S.R., Skoultchi,A., Weissman,S.M. and Kucherlapati,R. TITLE Identification, characterization, and precise mapping of a human gene encoding a novel membrane-spanning protein from the 22q11 region deleted in velo-cardio-facial syndrome JOURNAL Genomics 42 (2), 245-251 (1997) PUBMED 9192844 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BB872815.1, BC083341.1 and BE627334.1. On Aug 5, 2010 this sequence version replaced NM_013805.3. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. The protein encoded by this gene is a critical component of endothelial tight junctions that control pericellular permeability. The knockout mice lacking this gene died within 10 h of birth and the blood-brain barrier in these mice against small molecules was selectively affected. This gene is expressed strongly in endothelium of normal lung and plays a regulation role during acrolein-induced acute lung injury. [provided by RefSeq, Aug 2010]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript is intronless :: AK077282.1, AF035814.1 [ECO:0000345] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-10 BB872815.1 2-11 11-1413 BC083341.1 1-1403 1414-1420 BE627334.1 1-7 c FEATURES Location/Qualifiers source 1..1420 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="16" /map="16 11.63 cM" gene 1..1420 /gene="Cldn5" /gene_synonym="MBEC1; Tmvcf" /note="claudin 5" /db_xref="GeneID:12741" /db_xref="MGI:MGI:1276112" exon 1..1416 /gene="Cldn5" /gene_synonym="MBEC1; Tmvcf" /inference="alignment:Splign:2.1.0" misc_feature 87..89 /gene="Cldn5" /gene_synonym="MBEC1; Tmvcf" /note="upstream in-frame stop codon" CDS 150..806 /gene="Cldn5" /gene_synonym="MBEC1; Tmvcf" /note="lung-specific membrane protein; brain endothelial cell clone 1 protein; transmembrane protein deleted in VCFS" /codon_start=1 /product="claudin-5" /protein_id="NP_038833.2" /db_xref="CCDS:CCDS28026.1" /db_xref="GeneID:12741" /db_xref="MGI:MGI:1276112" /translation="
MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYESVLALSAEVQAARALTVGAVLLALVALFVTLTGAQCTTCVAPGPVKARVALTGGALYAVCGLLALVPLCWFANIVVREFYDPTVPVSQKYELGAALYIGWAASALLMCGGGLVCCGAWVCTGRPEFSFPVKYSAPRRPTANGDYDKKNYV"
misc_feature 162..689 /gene="Cldn5" /gene_synonym="MBEC1; Tmvcf" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" misc_feature 171..233 /gene="Cldn5" /gene_synonym="MBEC1; Tmvcf" /note="propagated from UniProtKB/Swiss-Prot (O54942.2); transmembrane region" misc_feature 393..455 /gene="Cldn5" /gene_synonym="MBEC1; Tmvcf" /note="propagated from UniProtKB/Swiss-Prot (O54942.2); transmembrane region" misc_feature 519..581 /gene="Cldn5" /gene_synonym="MBEC1; Tmvcf" /note="propagated from UniProtKB/Swiss-Prot (O54942.2); transmembrane region" misc_feature 630..692 /gene="Cldn5" /gene_synonym="MBEC1; Tmvcf" /note="propagated from UniProtKB/Swiss-Prot (O54942.2); transmembrane region" misc_feature 798..803 /gene="Cldn5" /gene_synonym="MBEC1; Tmvcf" /note="propagated from UniProtKB/Swiss-Prot (O54942.2); Region: Interactions with TJP1, TJP2 and TJP3. /evidence=ECO:0000250" regulatory 1393..1398 /regulatory_class="polyA_signal_sequence" /gene="Cldn5" /gene_synonym="MBEC1; Tmvcf" /note="hexamer: AGTAAA" polyA_site 1416 /gene="Cldn5" /gene_synonym="MBEC1; Tmvcf" /note="major polyA site" ORIGIN
agttggtgtagttaaaacctcctcttctgctccaggactggaggctccagagcagaggcaccagaatcaattcccagctcccagcctaagcagcgcagagagcacccggaggccccaagggccgtcgggtgagcattcagtctttagccatggggtctgcagcgttggaaattctgggtctggtgctgtgtctggtaggatgggtgggcttgatcctggcgtgtgggctgcccatgtggcaggtgactgccttcctggaccacaacatcgtgacggcgcagacgacttggaaggggctgtggatgtcgtgcgtggtgcagagtaccgggcacatgcagtgcaaggtgtatgaatctgtgctggcgctgagtgcggaggtgcaggcagctcgggcactcaccgtgggcgctgtgctgctggcgctggtggcactctttgttaccttgaccggcgctcagtgcaccacctgcgtggccccgggcccagttaaggcacgggtagcactcacgggaggagcgctttacgcggtgtgcgggctgctggcactcgtgccgctctgctggttcgccaacatcgttgtccgcgagttctatgatccgacggtgccggtgtcacagaagtacgagctgggcgcggcgctgtacatcggctgggcggcctccgcactgctcatgtgcggtggcggcctcgtgtgttgcggcgcctgggtctgcaccgggcgccctgagttcagcttcccggtcaagtactctgcgccgcggcggcccacggccaatggcgattacgacaagaagaactatgtctaagggcgggaggcatggcggggctcttcccgcagctaagcccgcgatgggaaagaccgatgcgggaagccgtgtgtggatgacgaccaccgctgggttgcgcagcgcaagtcatgctgggttcgggccagacttgcccgctctcagagtccgttgaccatcactagccgggccctgctcagaacagactacaggcacttttaagaacttgaccgaccttttcttctatgcgcagttggccacgacgtgggtggaacgctcagatttcatcggtgaagtaggcaccaaactgccgcgaacagttcctactgagatcctgggggcactagatgctgccttaatgtccagtggcacctgctaacctgaaagggcagctggagaaaccccggggctgccagagggacgtgttaaaaagggcattttctttgttagtggagaagaacctactgaaccaaaggacttagcctggacctggtctcactccagcactcccccaaggtgggggccctgtaggtaccagagccttagaggggttgccttcctcctggaagcttggggcttggggggtgggccgggcaagaatttgctcagtaaatggtttgaacactttcaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]