2025-10-14 08:55:21, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_013805 1420 bp mRNA linear ROD 29-JUL-2025 DEFINITION Mus musculus claudin 5 (Cldn5), mRNA. ACCESSION NM_013805 VERSION NM_013805.4 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1420) AUTHORS Geng,X., Chen,L., Ahmed,Z., Formigari,G.P., Ho,Y.C., Del Gaudio,I., Datilo,M.N., Azartash-Namin,Z.J., Heron,C., Shan,X., Keshari,R.S., Pal,S., Chen,H., Lupu,F., Xia,L., Randolph,G.J., Zawieja,S.D., Camerer,E., Davis,M.J. and Srinivasan,R.S. TITLE S1PR1 regulates lymphatic valve development and tertiary lymphoid organ formation in the ileum JOURNAL J Exp Med 222 (9) (2025) PUBMED 40553105 REFERENCE 2 (bases 1 to 1420) AUTHORS Feng,K., Wang,W., Gao,X., Yan,H., Xu,M., Fan,B., Jia,Q., Wang,C., Yu,J., Li,Y., Xu,Q., An,Y., Jiao,P., Wang,M., Sun,H., Kong,F., Gong,Y. and Zhao,S. TITLE Adipocyte CLDN5 promotes thermogenesis and energy expenditure through regulation of IL10 expression JOURNAL Nat Commun 16 (1), 6151 (2025) PUBMED 40610440 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1420) AUTHORS Schoofs,H., Daubel,N., Schnabellehner,S., Gronloh,M.L.B., Palacios Martinez,S., Halme,A., Marks,A.M., Jeansson,M., Barcos,S., Brakebusch,C., Benedito,R., Engelhardt,B., Vestweber,D., Gaengel,K., Linsenmeier,F., Schurmann,S., Saharinen,P., van Buul,J.D., Friedrich,O., Smith,R.S., Majda,M. and Makinen,T. TITLE Dynamic cytoskeletal regulation of cell shape supports resilience of lymphatic endothelium JOURNAL Nature 641 (8062), 465-475 (2025) PUBMED 40108458 REFERENCE 4 (bases 1 to 1420) AUTHORS Brown,S.N., Shallie,P., Sierra,C.A., Nayak,N., Odibo,A.O., Monaghan-Nichols,P. and Nayak,N.R. TITLE Spatiotemporal Angiogenic Patterns in the Development of the Mouse Fetal Blood-Brain Barrier System During Pregnancy JOURNAL Int J Mol Sci 26 (8), 3862 (2025) PUBMED 40332505 REMARK Publication Status: Online-Only REFERENCE 5 (bases 1 to 1420) AUTHORS Cantu Gutierrez,M.E., Hill,M.C., Largoza,G.E., Gillespie,W.B. 3rd, Martin,J.F. and Wythe,J.D. TITLE Mapping the transcriptional and epigenetic landscape of organotypic endothelial diversity in the developing and adult mouse JOURNAL Nat Cardiovasc Res 4 (4), 473-495 (2025) PUBMED 40097733 REFERENCE 6 (bases 1 to 1420) AUTHORS Citi,S. and Cordenonsi,M. TITLE Tight junction proteins JOURNAL Biochim Biophys Acta 1448 (1), 1-11 (1998) PUBMED 9824655 REMARK Review article REFERENCE 7 (bases 1 to 1420) AUTHORS Sutherland,H.F., Kim,U.J. and Scambler,P.J. TITLE Cloning and comparative mapping of the DiGeorge syndrome critical region in the mouse JOURNAL Genomics 52 (1), 37-43 (1998) PUBMED 9740669 REFERENCE 8 (bases 1 to 1420) AUTHORS Chen,Z., Zandonatti,M., Jakubowski,D. and Fox,H.S. TITLE Brain capillary endothelial cells express MBEC1, a protein that is related to the Clostridium perfringens enterotoxin receptors JOURNAL Lab Invest 78 (3), 353-363 (1998) PUBMED 9520948 REFERENCE 9 (bases 1 to 1420) AUTHORS Puech,A., Saint-Jore,B., Funke,B., Gilbert,D.J., Sirotkin,H., Copeland,N.G., Jenkins,N.A., Kucherlapati,R., Morrow,B. and Skoultchi,A.I. TITLE Comparative mapping of the human 22q11 chromosomal region and the orthologous region in mice reveals complex changes in gene organization JOURNAL Proc Natl Acad Sci U S A 94 (26), 14608-14613 (1997) PUBMED 9405660 REFERENCE 10 (bases 1 to 1420) AUTHORS Sirotkin,H., Morrow,B., Saint-Jore,B., Puech,A., Das Gupta,R., Patanjali,S.R., Skoultchi,A., Weissman,S.M. and Kucherlapati,R. TITLE Identification, characterization, and precise mapping of a human gene encoding a novel membrane-spanning protein from the 22q11 region deleted in velo-cardio-facial syndrome JOURNAL Genomics 42 (2), 245-251 (1997) PUBMED 9192844 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BB872815.1, BC083341.1 and BE627334.1. On Aug 5, 2010 this sequence version replaced NM_013805.3. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. The protein encoded by this gene is a critical component of endothelial tight junctions that control pericellular permeability. The knockout mice lacking this gene died within 10 h of birth and the blood-brain barrier in these mice against small molecules was selectively affected. This gene is expressed strongly in endothelium of normal lung and plays a regulation role during acrolein-induced acute lung injury. [provided by RefSeq, Aug 2010]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript is intronless :: AK077282.1, AF035814.1 [ECO:0000345] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-10 BB872815.1 2-11 11-1413 BC083341.1 1-1403 1414-1420 BE627334.1 1-7 c FEATURES Location/Qualifiers source 1..1420 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="16" /map="16 11.63 cM" gene 1..1420 /gene="Cldn5" /gene_synonym="MBEC1; Tmvcf" /note="claudin 5" /db_xref="GeneID:12741" /db_xref="MGI:MGI:1276112" exon 1..1416 /gene="Cldn5" /gene_synonym="MBEC1; Tmvcf" /inference="alignment:Splign:2.1.0" misc_feature 87..89 /gene="Cldn5" /gene_synonym="MBEC1; Tmvcf" /note="upstream in-frame stop codon" CDS 150..806 /gene="Cldn5" /gene_synonym="MBEC1; Tmvcf" /note="lung-specific membrane protein; brain endothelial cell clone 1 protein; transmembrane protein deleted in VCFS" /codon_start=1 /product="claudin-5" /protein_id="NP_038833.2" /db_xref="CCDS:CCDS28026.1" /db_xref="GeneID:12741" /db_xref="MGI:MGI:1276112" /translation="
MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYESVLALSAEVQAARALTVGAVLLALVALFVTLTGAQCTTCVAPGPVKARVALTGGALYAVCGLLALVPLCWFANIVVREFYDPTVPVSQKYELGAALYIGWAASALLMCGGGLVCCGAWVCTGRPEFSFPVKYSAPRRPTANGDYDKKNYV"
misc_feature 162..689 /gene="Cldn5" /gene_synonym="MBEC1; Tmvcf" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" misc_feature 171..233 /gene="Cldn5" /gene_synonym="MBEC1; Tmvcf" /note="propagated from UniProtKB/Swiss-Prot (O54942.2); transmembrane region" misc_feature 393..455 /gene="Cldn5" /gene_synonym="MBEC1; Tmvcf" /note="propagated from UniProtKB/Swiss-Prot (O54942.2); transmembrane region" misc_feature 519..581 /gene="Cldn5" /gene_synonym="MBEC1; Tmvcf" /note="propagated from UniProtKB/Swiss-Prot (O54942.2); transmembrane region" misc_feature 630..692 /gene="Cldn5" /gene_synonym="MBEC1; Tmvcf" /note="propagated from UniProtKB/Swiss-Prot (O54942.2); transmembrane region" misc_feature 798..803 /gene="Cldn5" /gene_synonym="MBEC1; Tmvcf" /note="propagated from UniProtKB/Swiss-Prot (O54942.2); Region: Interactions with TJP1, TJP2 and TJP3. /evidence=ECO:0000250" regulatory 1393..1398 /regulatory_class="polyA_signal_sequence" /gene="Cldn5" /gene_synonym="MBEC1; Tmvcf" /note="hexamer: AGTAAA" polyA_site 1416 /gene="Cldn5" /gene_synonym="MBEC1; Tmvcf" /note="major polyA site" ORIGIN
agttggtgtagttaaaacctcctcttctgctccaggactggaggctccagagcagaggcaccagaatcaattcccagctcccagcctaagcagcgcagagagcacccggaggccccaagggccgtcgggtgagcattcagtctttagccatggggtctgcagcgttggaaattctgggtctggtgctgtgtctggtaggatgggtgggcttgatcctggcgtgtgggctgcccatgtggcaggtgactgccttcctggaccacaacatcgtgacggcgcagacgacttggaaggggctgtggatgtcgtgcgtggtgcagagtaccgggcacatgcagtgcaaggtgtatgaatctgtgctggcgctgagtgcggaggtgcaggcagctcgggcactcaccgtgggcgctgtgctgctggcgctggtggcactctttgttaccttgaccggcgctcagtgcaccacctgcgtggccccgggcccagttaaggcacgggtagcactcacgggaggagcgctttacgcggtgtgcgggctgctggcactcgtgccgctctgctggttcgccaacatcgttgtccgcgagttctatgatccgacggtgccggtgtcacagaagtacgagctgggcgcggcgctgtacatcggctgggcggcctccgcactgctcatgtgcggtggcggcctcgtgtgttgcggcgcctgggtctgcaccgggcgccctgagttcagcttcccggtcaagtactctgcgccgcggcggcccacggccaatggcgattacgacaagaagaactatgtctaagggcgggaggcatggcggggctcttcccgcagctaagcccgcgatgggaaagaccgatgcgggaagccgtgtgtggatgacgaccaccgctgggttgcgcagcgcaagtcatgctgggttcgggccagacttgcccgctctcagagtccgttgaccatcactagccgggccctgctcagaacagactacaggcacttttaagaacttgaccgaccttttcttctatgcgcagttggccacgacgtgggtggaacgctcagatttcatcggtgaagtaggcaccaaactgccgcgaacagttcctactgagatcctgggggcactagatgctgccttaatgtccagtggcacctgctaacctgaaagggcagctggagaaaccccggggctgccagagggacgtgttaaaaagggcattttctttgttagtggagaagaacctactgaaccaaaggacttagcctggacctggtctcactccagcactcccccaaggtgggggccctgtaggtaccagagccttagaggggttgccttcctcctggaagcttggggcttggggggtgggccgggcaagaatttgctcagtaaatggtttgaacactttcaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]