GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-06-22 13:41:40, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_010646                870 bp    mRNA    linear   ROD 16-FEB-2022
DEFINITION  Mus musculus killer cell lectin-like receptor subfamily A, member
            12 (Klra12), mRNA.
ACCESSION   NM_010646 XM_003945728
VERSION     NM_010646.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 870)
  AUTHORS   Schenkel AR, Kingry LC and Slayden RA.
  TITLE     The ly49 gene family. A brief guide to the nomenclature, genetics,
            and role in intracellular infection
  JOURNAL   Front Immunol 4, 90 (2013)
   PUBMED   23596445
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 870)
  AUTHORS   Back J, Malchiodi EL, Cho S, Scarpellino L, Schneider P, Kerzic MC,
            Mariuzza RA and Held W.
  TITLE     Distinct conformations of Ly49 natural killer cell receptors
            mediate MHC class I recognition in trans and cis
  JOURNAL   Immunity 31 (4), 598-608 (2009)
   PUBMED   19818651
  REMARK    GeneRIF: The distinct conformations (backfolded and extended)
            define the structural basis for cis-trans binding by Ly49 receptors
            and explain the divergent functional consequences of cis versus
            trans interactions.
REFERENCE   3  (bases 1 to 870)
  AUTHORS   Makrigiannis AP, Patel D, Goulet ML, Dewar K and Anderson SK.
  TITLE     Direct sequence comparison of two divergent class I MHC natural
            killer cell receptor haplotypes
  JOURNAL   Genes Immun 6 (2), 71-83 (2005)
   PUBMED   15674375
REFERENCE   4  (bases 1 to 870)
  AUTHORS   Proteau MF, Rousselle E and Makrigiannis AP.
  TITLE     Mapping of the BALB/c Ly49 cluster defines a minimal natural killer
            cell receptor gene repertoire
  JOURNAL   Genomics 84 (4), 669-677 (2004)
   PUBMED   15475244
REFERENCE   5  (bases 1 to 870)
  AUTHORS   Makrigiannis AP, Pau AT, Schwartzberg PL, McVicar DW, Beck TW and
            Anderson SK.
  TITLE     A BAC contig map of the Ly49 gene cluster in 129 mice reveals
            extensive differences in gene content relative to C57BL/6 mice
  JOURNAL   Genomics 79 (3), 437-444 (2002)
   PUBMED   11863373
REFERENCE   6  (bases 1 to 870)
  AUTHORS   Makrigiannis AP, Pau AT, Saleh A, Winkler-Pickett R, Ortaldo JR and
            Anderson SK.
  TITLE     Class I MHC-binding characteristics of the 129/J Ly49 repertoire
  JOURNAL   J Immunol 166 (8), 5034-5043 (2001)
   PUBMED   11290784
REFERENCE   7  (bases 1 to 870)
  AUTHORS   Silver ET, Gong D, Hazes B and Kane KP.
  TITLE     Ly-49W, an activating receptor of nonobese diabetic mice with close
            homology to the inhibitory receptor Ly-49G, recognizes H-2D(k) and
            H-2D(d)
  JOURNAL   J Immunol 166 (4), 2333-2341 (2001)
   PUBMED   11160290
REFERENCE   8  (bases 1 to 870)
  AUTHORS   Makrigiannis AP, Etzler J, Winkler-Pickett R, Mason A, Ortaldo JR
            and Anderson SK.
  TITLE     Identification of the Ly49L protein: evidence for activating
            counterparts to inhibitory Ly49 proteins
  JOURNAL   J Leukoc Biol 68 (5), 765-771 (2000)
   PUBMED   11073118
REFERENCE   9  (bases 1 to 870)
  AUTHORS   Depatie C, Lee SH, Stafford A, Avner P, Belouchi A, Gros P and
            Vidal SM.
  TITLE     Sequence-ready BAC contig, physical, and transcriptional map of a
            2-Mb region overlapping the mouse chromosome 6 host-resistance
            locus Cmv1
  JOURNAL   Genomics 66 (2), 161-174 (2000)
   PUBMED   10860661
REFERENCE   10 (bases 1 to 870)
  AUTHORS   McQueen KL, Freeman JD, Takei F and Mager DL.
  TITLE     Localization of five new Ly49 genes, including three closely
            related to Ly49c
  JOURNAL   Immunogenetics 48 (3), 174-183 (1998)
   PUBMED   9683662
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AF307948.1.
            
            On Oct 10, 2012 this sequence version replaced XM_003945728.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF307948.1 [ECO:0000332]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..870
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="BALB/c"
                     /db_xref="taxon:10090"
                     /chromosome="6"
                     /map="6"
     gene            1..870
                     /gene="Klra12"
                     /gene_synonym="Ly49L; Ly49l1; Ly49l2; Ly49l3; Ly49l4;
                     Ly49p/d"
                     /note="killer cell lectin-like receptor subfamily A,
                     member 12"
                     /db_xref="GeneID:16630"
                     /db_xref="MGI:MGI:1321091"
     CDS             58..855
                     /gene="Klra12"
                     /gene_synonym="Ly49L; Ly49l1; Ly49l2; Ly49l3; Ly49l4;
                     Ly49p/d"
                     /note="novel killer cell lectin-like receptor, subfamily A
                     protein"
                     /codon_start=1
                     /product="killer cell lectin-like receptor subfamily A,
                     member 12"
                     /protein_id="NP_034776.1"
                     /db_xref="GeneID:16630"
                     /db_xref="MGI:MGI:1321091"
                     /translation="
MSEQEVTFSAVRFHKSSGLQNRVRLEETGKPQKAGLRVPWQLIVIALGILISLRLVIVSVLVTNIFQNSQQNHELQETLNCHDKCSTTTQSDINLKDELLSSTSIECRPGNDLLESLHKEQNRWYSETKTFSDSSQHTGRGFEKYWFCYGIKCYYFVMDRKTWSGCKQTCQISSLSLLKIDNEDELKFLKLLVPSDSCWIGLSYDNKKKDWAWINNGPSKLALNTMKYNIRDGGCMLLSKTRLDNDNCDKSFICICGKRLDKFPH"
     misc_feature    169..525
                     /gene="Klra12"
                     /gene_synonym="Ly49L; Ly49l1; Ly49l2; Ly49l3; Ly49l4;
                     Ly49p/d"
                     /note="Ly49-like protein, N-terminal region; Region: Ly49;
                     pfam08391"
                     /db_xref="CDD:462461"
     misc_feature    484..831
                     /gene="Klra12"
                     /gene_synonym="Ly49L; Ly49l1; Ly49l2; Ly49l3; Ly49l4;
                     Ly49p/d"
                     /note="C-type lectin-like domain (CTLD) of the type found
                     in natural killer cell receptors (NKRs); Region:
                     CLECT_NK_receptors_like; cd03593"
                     /db_xref="CDD:153063"
     misc_feature    order(646..648,727..729,781..783,787..792)
                     /gene="Klra12"
                     /gene_synonym="Ly49L; Ly49l1; Ly49l2; Ly49l3; Ly49l4;
                     Ly49p/d"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153063"
ORIGIN      
cacagaaatcactcaaggacatattttaaaagagaacatactctacatcctcccaagatgagtgagcaggaggtcactttctcagctgtgagattccataagtcttcagggttgcagaaccgggtgaggcttgaggagacagggaagcctcaaaaagctggcctcagagttccctggcagctcattgtgatagctctcggaatcctcatttcccttcgactggtaattgtctcagtgcttgtgacaaacatttttcagaatagtcaacaaaatcatgaactgcaggaaactctaaactgccacgataagtgcagcaccaccactcaaagtgacatcaacttgaaggatgaactgctgagttctacatctatagagtgtaggccaggcaatgatcttctggaatccctccacaaggaacagaacagatggtacagtgaaaccaagactttttcagattcctcacagcacacaggcagaggttttgaaaaatattggttctgttatggtataaaatgttattatttcgtcatggacagaaaaacgtggagtggatgtaaacagacctgccagatttccagcttatcccttctgaagatagacaatgaggatgaactgaagttccttaagctcctggttccttcagacagttgctggattggattgtcatatgataataagaagaaagattgggcatggattaacaatggcccatctaaacttgccttgaacacaatgaaatataatataagagatggaggatgtatgttgttatctaaaacaagactagacaatgataactgtgataaatcattcatctgtatttgtgggaagagattggataaattccctcattgactctccagtgagtgt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]