GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-06-18 21:36:54, GGRNA.v2 : RefSeq release 224 (May, 2024)

LOCUS       NM_009639               1436 bp    mRNA    linear   ROD 02-MAY-2024
DEFINITION  Mus musculus cysteine-rich secretory protein 3 (Crisp3), mRNA.
ACCESSION   NM_009639 XM_001002056
VERSION     NM_009639.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1436)
  AUTHORS   Adams,D.J., Barlas,B., McIntyre,R.E., Salguero,I., van der
            Weyden,L., Barros,A., Vicente,J.R., Karimpour,N., Haider,A.,
            Ranzani,M., Turner,G., Thompson,N.A., Harle,V., Olvera-Leon,R.,
            Robles-Espinoza,C.D., Speak,A.O., Geisler,N., Weninger,W.J.,
            Geyer,S.H., Hewinson,J., Karp,N.A., Fu,B., Yang,F., Kozik,Z.,
            Choudhary,J., Yu,L., van Ruiten,M.S., Rowland,B.D., Lelliott,C.J.,
            Del Castillo Velasco-Herrera,M., Verstraten,R., Bruckner,L.,
            Henssen,A.G., Rooimans,M.A., de Lange,J., Mohun,T.J., Arends,M.J.,
            Kentistou,K.A., Coelho,P.A., Zhao,Y., Zecchini,H., Perry,J.R.B.,
            Jackson,S.P. and Balmus,G.
  CONSRTM   Sanger Mouse Genetics Project
  TITLE     Genetic determinants of micronucleus formation in vivo
  JOURNAL   Nature 627 (8002), 130-136 (2024)
   PUBMED   38355793
REFERENCE   2  (bases 1 to 1436)
  AUTHORS   Curci,L., Brukman,N.G., Weigel Munoz,M., Rojo,D., Carvajal,G.,
            Sulzyk,V., Gonzalez,S.N., Rubinstein,M., Da Ros,V.G. and
            Cuasnicu,P.S.
  TITLE     Functional redundancy and compensation: Deletion of multiple murine
            Crisp genes reveals their essential role for male fertility
  JOURNAL   FASEB J 34 (12), 15718-15733 (2020)
   PUBMED   33037689
REFERENCE   3  (bases 1 to 1436)
  AUTHORS   Evans,J., D'Sylva,R., Volpert,M., Jamsai,D., Merriner,D.J., Nie,G.,
            Salamonsen,L.A. and O'Bryan,M.K.
  TITLE     Endometrial CRISP3 is regulated throughout the mouse estrous and
            human menstrual cycle and facilitates adhesion and proliferation of
            endometrial epithelial cells
  JOURNAL   Biol Reprod 92 (4), 99 (2015)
   PUBMED   25715794
  REMARK    GeneRIF: These data suggest roles for epithelial and
            neutrophil-derived CRISP3 in endometrial repair and regeneration
REFERENCE   4  (bases 1 to 1436)
  AUTHORS   Islam,M.N., Itoh,S., Yanagita,T., Sumiyoshi,K., Hayano,S.,
            Kuremoto,K., Kurosaka,H., Honjo,T., Kawanabe,N., Kamioka,H.,
            Sakai,T., Ishimaru,N., Taniuchi,I. and Yamashiro,T.
  TITLE     Runx/Cbfb signaling regulates postnatal development of granular
            convoluted tubule in the mouse submandibular gland
  JOURNAL   Dev Dyn 244 (3), 488-496 (2015)
   PUBMED   25410786
REFERENCE   5  (bases 1 to 1436)
  AUTHORS   Dike,S., Balija,V.S., Nascimento,L.U., Xuan,Z., Ou,J., Zutavern,T.,
            Palmer,L.E., Hannon,G., Zhang,M.Q. and McCombie,W.R.
  TITLE     The mouse genome: experimental examination of gene predictions and
            transcriptional start sites
  JOURNAL   Genome Res 14 (12), 2424-2429 (2004)
   PUBMED   15574821
REFERENCE   6  (bases 1 to 1436)
  AUTHORS   Haendler,B., Habenicht,U.F., Schwidetzky,U., Schuttke,I. and
            Schleuning,W.D.
  TITLE     Differential androgen regulation of the murine genes for
            cysteine-rich secretory proteins (CRISP)
  JOURNAL   Eur J Biochem 250 (2), 440-446 (1997)
   PUBMED   9428696
REFERENCE   7  (bases 1 to 1436)
  AUTHORS   Schwidetzky,U., Haendler,B. and Schleuning,W.D.
  TITLE     Isolation and characterization of the androgen-dependent mouse
            cysteine-rich secretory protein-3 (CRISP-3) gene
  JOURNAL   Biochem J 309 (Pt 3) (Pt 3), 831-836 (1995)
   PUBMED   7639699
REFERENCE   8  (bases 1 to 1436)
  AUTHORS   Kasahara,M., Hayashi,M., Yoshida,M.C., Nadeau,J.H., Fujimoto,S. and
            Ishibashi,T.
  TITLE     Mapping of acidic epididymal glycoprotein (Aeg) genes to mouse
            chromosome 17
  JOURNAL   Mamm Genome 6 (1), 52-54 (1995)
   PUBMED   7719028
REFERENCE   9  (bases 1 to 1436)
  AUTHORS   Haendler,B., Kratzschmar,J., Theuring,F. and Schleuning,W.D.
  TITLE     Transcripts for cysteine-rich secretory protein-1 (CRISP-1; DE/AEG)
            and the novel related CRISP-3 are expressed under androgen control
            in the mouse salivary gland
  JOURNAL   Endocrinology 133 (1), 192-198 (1993)
   PUBMED   8319566
REFERENCE   10 (bases 1 to 1436)
  AUTHORS   Mizuki,N. and Kasahara,M.
  TITLE     Mouse submandibular glands express an androgen-regulated transcript
            encoding an acidic epididymal glycoprotein-like molecule
  JOURNAL   Mol Cell Endocrinol 89 (1-2), 25-32 (1992)
   PUBMED   1301383
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            CV307357.1 and L05560.1.
            
            On Mar 28, 2018 this sequence version replaced NM_009639.2.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: L05560.1, BC022573.1 [ECO:0000332]
            RNAseq introns              :: mixed sample support SAMN00849375,
                                           SAMN00849378 [ECO:0006172]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-30                CV307357.1         1-30
            31-1436             L05560.1           1-1406
FEATURES             Location/Qualifiers
     source          1..1436
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10090"
                     /chromosome="17"
                     /map="17 19.45 cM"
     gene            1..1436
                     /gene="Crisp3"
                     /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28"
                     /note="cysteine-rich secretory protein 3"
                     /db_xref="GeneID:11572"
                     /db_xref="MGI:MGI:102552"
     exon            1..53
                     /gene="Crisp3"
                     /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28"
                     /inference="alignment:Splign:2.1.0"
     exon            54..127
                     /gene="Crisp3"
                     /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28"
                     /inference="alignment:Splign:2.1.0"
     CDS             56..781
                     /gene="Crisp3"
                     /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28"
                     /note="SCP 2; sperm-coating glycoprotein 2; acidic
                     epididymal glycoprotein 2"
                     /codon_start=1
                     /product="cysteine-rich secretory protein 3 precursor"
                     /protein_id="NP_033769.1"
                     /db_xref="CCDS:CCDS28783.1"
                     /db_xref="GeneID:11572"
                     /db_xref="MGI:MGI:102552"
                     /translation="
MALMLVLFFLAAVLPPSLLQDNSQENSLEKLSTSKKSVQEEIVSKHNQLRRKVSPSGSDLLNMEWNYDAQVNAQQRADKCTFSHSPIELRTTNLKCGENLFMSSYLVPWSSVIQGWYNESKGLIFGVGPKQNVSVVGHHTQVVWKSNLQVACGVAECPENPLRYFYVCRYCPVLNYSGHYPSRPYLAYTARAPCASCPDRCEDGLCTKSCQYKDMSFWCKRLEYVCKHPGLKKRCLATCQC"
     sig_peptide     56..112
                     /gene="Crisp3"
                     /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28"
                     /inference="COORDINATES: ab initio prediction:SignalP:6.0"
     mat_peptide     113..778
                     /gene="Crisp3"
                     /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28"
                     /product="Cysteine-rich secretory protein 3.
                     /id=PRO_0000006269"
                     /note="propagated from UniProtKB/Swiss-Prot (Q03402.1)"
     misc_feature    164..571
                     /gene="Crisp3"
                     /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28"
                     /note="CAP (cysteine-rich secretory proteins, antigen 5,
                     and pathogenesis-related 1 proteins) domain family;
                     Region: CAP; cl00133"
                     /db_xref="CDD:412178"
     misc_feature    407..409
                     /gene="Crisp3"
                     /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (Q03402.1); glycosylation site"
     misc_feature    449..451
                     /gene="Crisp3"
                     /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (Q03402.1); glycosylation site"
     misc_feature    578..580
                     /gene="Crisp3"
                     /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (Q03402.1); glycosylation site"
     misc_feature    635..778
                     /gene="Crisp3"
                     /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28"
                     /note="Region: Crisp; pfam08562"
                     /db_xref="CDD:462519"
     exon            128..244
                     /gene="Crisp3"
                     /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28"
                     /inference="alignment:Splign:2.1.0"
     exon            245..332
                     /gene="Crisp3"
                     /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28"
                     /inference="alignment:Splign:2.1.0"
     exon            333..478
                     /gene="Crisp3"
                     /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28"
                     /inference="alignment:Splign:2.1.0"
     exon            479..573
                     /gene="Crisp3"
                     /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28"
                     /inference="alignment:Splign:2.1.0"
     exon            574..674
                     /gene="Crisp3"
                     /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28"
                     /inference="alignment:Splign:2.1.0"
     exon            675..1417
                     /gene="Crisp3"
                     /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1392..1397
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Crisp3"
                     /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28"
                     /note="hexamer: AATAAA"
     polyA_site      1417
                     /gene="Crisp3"
                     /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28"
                     /note="major polyA site"
ORIGIN      
gtcacctttcttcttcctgcaggacaacacctcattctactctgaagccagcaccatggcattaatgcttgtgctgttcttcctggctgctgtactgcccccatcccttcttcaagataactctcaggagaacagtcttgagaaactttcaaccagtaaaaaatcagtccaagaagagattgtaagcaagcacaaccaattgagacgaaaggtttctccatctggcagtgacttactaaatatggaatggaactatgatgctcaagtgaatgctcagcaacgggcagacaagtgtacattcagtcacagtcctatagaactcaggacaactaatttaaaatgtggtgagaatttgttcatgtcatcttaccttgtaccatggtcttctgtaatccaaggatggtataatgaatccaaaggtcttatatttggtgtgggcccaaagcaaaatgttagtgtggttggacatcatactcaggttgtttggaaatcaaatttacaagttgcatgtggagttgctgaatgccctgaaaatccactgagatacttttatgtttgtcgctattgtcctgtattgaattacagtggccattatccaagcaggccatacctagcttacacagcaagagcaccatgtgccagttgtcctgatcgctgtgaagatggactgtgcaccaagagttgtcaatataaggatatgtctttttggtgtaaacgtctggaatacgtctgtaaacatccaggtcttaaaaaacgttgcctagctacatgccaatgttaaggcaaaattcactaaatttcctgtccaggctgccaggaccaagtagagaaaggtcatactctctagtcaggcttatcacatcccaccaagaatatatagatttaatacattggaacaattccagatggtaaagattctgtttcttcttctatttctttctattttgcagatatcatttaccccaaatattttaaagtaacaaaattgataataacctttggaccttgacatttgaaatctgtgacacattcatgaagtcaaatctagccaatgactatacattgtctgtatgactaaagtcactaaaactcatatgactaatgttccaagagcacaatgaagtaagggaatagaaaacatatagttcctgtgtaatggtcagtcatcttttgtagctctacctagttaagtctctctgaagaaaattcacattgtctttttttttttctcactattcattattcttcacattcaacataatcagtggtttaaattctaaaataccatttacattttagttgtttttttttctaagaatgatataaaatgtaccttaatgagaagaatttgcttgttcaggggacaatgacctttgttgctttagaaaaaaaataaatcttaatcttggcttattaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]