GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-09-13 01:16:05, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_009638               1416 bp    mRNA    linear   ROD 23-JUN-2025
DEFINITION  Mus musculus cysteine-rich secretory protein 1 (Crisp1), mRNA.
ACCESSION   NM_009638
VERSION     NM_009638.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1416)
  AUTHORS   Short,K.L., Lao,J., Lam,R., Moreau,J.L.M., Ng,J., Piran,M.,
            Combes,A.N., Cottle,D.L. and Cole,T.J.
  TITLE     Disrupted glucocorticoid receptor cell signalling causes a
            ciliogenesis defect in the fetal mouse renal tubule
  JOURNAL   EMBO Rep 26 (11), 2883-2909 (2025)
   PUBMED   40247090
REFERENCE   2  (bases 1 to 1416)
  AUTHORS   Gaikwad,A.S., Nandagiri,A., Potter,D.L., Nosrati,R., O'Connor,A.E.,
            Jadhav,S., Soria,J., Prabhakar,R. and O'Bryan,M.K.
  TITLE     CRISPs Function to Boost Sperm Power Output and Motility
  JOURNAL   Front Cell Dev Biol 9, 693258 (2021)
   PUBMED   34422816
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1416)
  AUTHORS   Curci,L., Brukman,N.G., Weigel Munoz,M., Rojo,D., Carvajal,G.,
            Sulzyk,V., Gonzalez,S.N., Rubinstein,M., Da Ros,V.G. and
            Cuasnicu,P.S.
  TITLE     Functional redundancy and compensation: Deletion of multiple murine
            Crisp genes reveals their essential role for male fertility
  JOURNAL   FASEB J 34 (12), 15718-15733 (2020)
   PUBMED   33037689
REFERENCE   4  (bases 1 to 1416)
  AUTHORS   Weigel Munoz,M., Carvajal,G., Curci,L., Gonzalez,S.N. and
            Cuasnicu,P.S.
  TITLE     Relevance of CRISP proteins for epididymal physiology,
            fertilization, and fertility
  JOURNAL   Andrology 7 (5), 610-617 (2019)
   PUBMED   31218833
  REMARK    Review article
REFERENCE   5  (bases 1 to 1416)
  AUTHORS   Carvajal,G., Brukman,N.G., Weigel Munoz,M., Battistone,M.A.,
            Guazzone,V.A., Ikawa,M., Haruhiko,M., Lustig,L., Breton,S. and
            Cuasnicu,P.S.
  TITLE     Impaired male fertility and abnormal epididymal epithelium
            differentiation in mice lacking CRISP1 and CRISP4
  JOURNAL   Sci Rep 8 (1), 17531 (2018)
   PUBMED   30510210
  REMARK    GeneRIF: These observations reveal that CRISP proteins are relevant
            for epididymal epithelium differentiation and male fertility,
            contributing to a better understanding of the fine-tuning
            mechanisms underlying sperm maturation and immunotolerance in the
            epididymis with clear implications for human epididymal physiology
            and pathology.
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1416)
  AUTHORS   Leem,E., Kim,H.J., Choi,M., Kim,S., Oh,Y.S., Lee,K.J., Choe,Y.S.,
            Um,J.Y., Shin,W.H., Jeong,J.Y., Jin,B.K., Kim,D.W., McLean,C.,
            Fisher,P.B., Kholodilov,N., Ahn,K.S., Lee,J.M., Jung,U.J., Lee,S.G.
            and Kim,S.R.
  TITLE     Upregulation of neuronal astrocyte elevated gene-1 protects nigral
            dopaminergic neurons in vivo
  JOURNAL   Cell Death Dis 9 (5), 449 (2018)
   PUBMED   29670079
  REMARK    GeneRIF: these results demonstrated that the sustained level of
            AEG-1 as an important anti-apoptotic factor in nigral dopaminergic
            (DA) neurons might potentiate the therapeutic effects of
            treatments, such as Rheb(S16H) administration, on the degeneration
            of the DA pathway that characterizes Parkinson's disease.
            Publication Status: Online-Only
REFERENCE   7  (bases 1 to 1416)
  AUTHORS   Eberspaecher,U., Roosterman,D., Kratzschmar,J., Haendler,B.,
            Habenicht,U.F., Becker,A., Quensel,C., Petri,T., Schleuning,W.D.
            and Donner,P.
  TITLE     Mouse androgen-dependent epididymal glycoprotein CRISP-1 (DE/AEG):
            isolation, biochemical characterization, and expression in
            recombinant form
  JOURNAL   Mol Reprod Dev 42 (2), 157-172 (1995)
   PUBMED   8562061
REFERENCE   8  (bases 1 to 1416)
  AUTHORS   Kasahara,M., Hayashi,M., Yoshida,M.C., Nadeau,J.H., Fujimoto,S. and
            Ishibashi,T.
  TITLE     Mapping of acidic epididymal glycoprotein (Aeg) genes to mouse
            chromosome 17
  JOURNAL   Mamm Genome 6 (1), 52-54 (1995)
   PUBMED   7719028
REFERENCE   9  (bases 1 to 1416)
  AUTHORS   Haendler,B., Kratzschmar,J., Theuring,F. and Schleuning,W.D.
  TITLE     Transcripts for cysteine-rich secretory protein-1 (CRISP-1; DE/AEG)
            and the novel related CRISP-3 are expressed under androgen control
            in the mouse salivary gland
  JOURNAL   Endocrinology 133 (1), 192-198 (1993)
   PUBMED   8319566
REFERENCE   10 (bases 1 to 1416)
  AUTHORS   Mizuki,N. and Kasahara,M.
  TITLE     Mouse submandibular glands express an androgen-regulated transcript
            encoding an acidic epididymal glycoprotein-like molecule
  JOURNAL   Mol Cell Endocrinol 89 (1-2), 25-32 (1992)
   PUBMED   1301383
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AK009449.1, M92849.1 and AC154497.2.
            
            On Oct 6, 2007 this sequence version replaced NM_009638.2.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC011150.1, AK009449.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849381, SAMN00849384
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-34                AK009449.1         2-35
            35-1414             M92849.1           1-1380
            1415-1416           AC154497.2         170045-170046       c
FEATURES             Location/Qualifiers
     source          1..1416
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="17"
                     /map="17 19.47 cM"
     gene            1..1416
                     /gene="Crisp1"
                     /gene_synonym="Aeg1; CRISP-1; SCP 1"
                     /note="cysteine-rich secretory protein 1"
                     /db_xref="GeneID:11571"
                     /db_xref="MGI:MGI:102553"
     exon            1..53
                     /gene="Crisp1"
                     /gene_synonym="Aeg1; CRISP-1; SCP 1"
                     /inference="alignment:Splign:2.1.0"
     exon            54..127
                     /gene="Crisp1"
                     /gene_synonym="Aeg1; CRISP-1; SCP 1"
                     /inference="alignment:Splign:2.1.0"
     CDS             56..790
                     /gene="Crisp1"
                     /gene_synonym="Aeg1; CRISP-1; SCP 1"
                     /note="sperm-coating glycoprotein 1; acidic epididymal
                     glycoprotein 1"
                     /codon_start=1
                     /product="cysteine-rich secretory protein 1 precursor"
                     /protein_id="NP_033768.3"
                     /db_xref="CCDS:CCDS28784.1"
                     /db_xref="GeneID:11571"
                     /db_xref="MGI:MGI:102553"
                     /translation="
MALMLVLFFLAAVLPPSLLQDSSQENRLEKLSTTKMSVQEEIVSKHNQLRRMVSPSGSDLLKMEWNYDAQVNAQQWADKCTFSHSPIELRTTNLRCGENLFMSSYLASWSSAIQGWYNEYKDLTYDVGPKQPDSVVGHYTQVVWNSTFQVACGVAECPKNPLRYYYVCHYCPVGNYQGRLYTPYTAGEPCASCPDHCEDGLCTNSCGHEDKYTNCKYLKKMLSCEHELLKKGCKATCLCEGKIH"
     sig_peptide     56..112
                     /gene="Crisp1"
                     /gene_synonym="Aeg1; CRISP-1; SCP 1"
                     /inference="COORDINATES: ab initio prediction:SignalP:6.0"
     mat_peptide     113..787
                     /gene="Crisp1"
                     /gene_synonym="Aeg1; CRISP-1; SCP 1"
                     /product="Cysteine-rich secretory protein 1.
                     /id=PRO_0000006262"
                     /note="propagated from UniProtKB/Swiss-Prot (Q03401.1)"
     misc_feature    164..571
                     /gene="Crisp1"
                     /gene_synonym="Aeg1; CRISP-1; SCP 1"
                     /note="CAP (cysteine-rich secretory proteins, antigen 5,
                     and pathogenesis-related 1 proteins) domain of
                     cysteine-rich secretory proteins; Region: CAP_CRISP;
                     cd05383"
                     /db_xref="CDD:349402"
     misc_feature    488..490
                     /gene="Crisp1"
                     /gene_synonym="Aeg1; CRISP-1; SCP 1"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (Q03401.1); glycosylation site"
     misc_feature    623..787
                     /gene="Crisp1"
                     /gene_synonym="Aeg1; CRISP-1; SCP 1"
                     /note="Region: Crisp; pfam08562"
                     /db_xref="CDD:462519"
     exon            128..244
                     /gene="Crisp1"
                     /gene_synonym="Aeg1; CRISP-1; SCP 1"
                     /inference="alignment:Splign:2.1.0"
     exon            245..332
                     /gene="Crisp1"
                     /gene_synonym="Aeg1; CRISP-1; SCP 1"
                     /inference="alignment:Splign:2.1.0"
     exon            333..478
                     /gene="Crisp1"
                     /gene_synonym="Aeg1; CRISP-1; SCP 1"
                     /inference="alignment:Splign:2.1.0"
     exon            479..573
                     /gene="Crisp1"
                     /gene_synonym="Aeg1; CRISP-1; SCP 1"
                     /inference="alignment:Splign:2.1.0"
     exon            574..662
                     /gene="Crisp1"
                     /gene_synonym="Aeg1; CRISP-1; SCP 1"
                     /inference="alignment:Splign:2.1.0"
     exon            663..1416
                     /gene="Crisp1"
                     /gene_synonym="Aeg1; CRISP-1; SCP 1"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1391..1396
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Crisp1"
                     /gene_synonym="Aeg1; CRISP-1; SCP 1"
                     /note="hexamer: AATAAA"
     polyA_site      1416
                     /gene="Crisp1"
                     /gene_synonym="Aeg1; CRISP-1; SCP 1"
                     /note="major polyA site"
ORIGIN      
gtcacctttcttcttcctgcagaacaacgcctcattctactctgaagccagcaccatggcattaatgcttgtgctgttcttcttggctgctgtactgcccccatcccttcttcaagatagctctcaggaaaatcgtcttgagaaactttcaaccactaaaatgtcagtccaagaagagattgtaagcaagcacaaccaattgagacgaatggtttctccatctggcagtgacttactaaaaatggaatggaactatgatgctcaagtgaatgctcagcaatgggcagacaagtgtacattcagtcacagtcctatagaactcaggacaactaatttaagatgtggggagaatttgttcatgtcatcttaccttgcatcatggtcttctgcaatccaaggatggtataatgaatacaaagatcttacatatgatgttggcccaaagcaacctgatagtgtggttggacattatactcaggttgtttggaactcaactttccaagttgcatgtggagttgctgaatgccctaaaaatccactgagatactattatgtttgtcactattgtcctgttggcaattatcaaggaaggctatacacaccttacactgcaggagaaccgtgtgccagttgtcctgatcactgtgaagatgggctatgcaccaatagttgtggacatgaagataagtatactaactgtaaatatctgaagaagatgctatcctgtgaacatgaacttcttaaaaaaggttgcaaagctacatgcctctgtgaaggcaaaattcactaaatttcctgtactcgtagccaggaccatgtagagaaagctcatactctctagttaggcttatcacatcccaccaagaaagtatagatttaggacattgaaataattccagatagtaaagattctgtttcttcttctatttctttctattttacagaaatcatttaccccaaatattttaaaataacaaatttgataatacctttgtaccttgacatatgaaatctgtgacacattttcggagtcaagtctagcccatgattatacattgtctgtatgactaaagtcactaaaactcatatgactaatgttccaagagcacaatgaagtaaaggaatagaaaacatatagttcctgtataatggtcagtcatcttttctagctctacctagtttactctctctggagaaaatcacattaatcgtcttttattttctttctcactattccttattcttcaaattcatcataatcagtggtttaaattctaaactactatttacattttagtttttttaaagaatgatataaaatgtaccttaacgagcagaatttatagtttgcttgttcaggggacaatgacctttgttgctttagaaaaataataaatcttaatcttggcatgttaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]