2025-09-17 01:14:21, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS NM_008955 882 bp mRNA linear ROD 04-AUG-2023 DEFINITION Mus musculus reproductive homeobox 6 (Rhox6), mRNA. ACCESSION NM_008955 VERSION NM_008955.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 882) AUTHORS Nowotschin S, Setty M, Kuo YY, Liu V, Garg V, Sharma R, Simon CS, Saiz N, Gardner R, Boutet SC, Church DM, Hoodless PA, Hadjantonakis AK and Pe'er D. TITLE The emergent landscape of the mouse gut endoderm at single-cell resolution JOURNAL Nature 569 (7756), 361-367 (2019) PUBMED 30959515 REFERENCE 2 (bases 1 to 882) AUTHORS Thompson CL, Ng L, Menon V, Martinez S, Lee CK, Glattfelder K, Sunkin SM, Henry A, Lau C, Dang C, Garcia-Lopez R, Martinez-Ferre A, Pombero A, Rubenstein JLR, Wakeman WB, Hohmann J, Dee N, Sodt AJ, Young R, Smith K, Nguyen TN, Kidney J, Kuan L, Jeromin A, Kaykas A, Miller J, Page D, Orta G, Bernard A, Riley Z, Smith S, Wohnoutka P, Hawrylycz MJ, Puelles L and Jones AR. TITLE A high-resolution spatiotemporal atlas of gene expression of the developing mouse brain JOURNAL Neuron 83 (2), 309-323 (2014) PUBMED 24952961 REFERENCE 3 (bases 1 to 882) AUTHORS Wang Q, Liu X, Tang N, Archambeault DR, Li J, Song H, Tang C, He B, Matzuk MM and Wang Y. TITLE GASZ promotes germ cell derivation from embryonic stem cells JOURNAL Stem Cell Res 11 (2), 845-860 (2013) PUBMED 23816659 REFERENCE 4 (bases 1 to 882) AUTHORS Oda M, Oxley D, Dean W and Reik W. TITLE Regulation of lineage specific DNA hypomethylation in mouse trophectoderm JOURNAL PLoS One 8 (6), e68846 (2013) PUBMED 23825703 REMARK Publication Status: Online-Only REFERENCE 5 (bases 1 to 882) AUTHORS Berletch JB, Deng X, Nguyen DK and Disteche CM. TITLE Female bias in Rhox6 and 9 regulation by the histone demethylase KDM6A JOURNAL PLoS Genet 9 (5), e1003489 (2013) PUBMED 23658530 REMARK GeneRIF: We report that two members of the Rhox cluster, Rhox6 and 9, are regulated by de-methylation of histone H3 at lysine 27 by KDM6A REFERENCE 6 (bases 1 to 882) AUTHORS Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML, Macleod C and Wilkinson MF. TITLE Rhox: a new homeobox gene cluster JOURNAL Cell 120 (3), 369-382 (2005) PUBMED 15707895 REFERENCE 7 (bases 1 to 882) AUTHORS Small CL, Shima JE, Uzumcu M, Skinner MK and Griswold MD. TITLE Profiling gene expression during the differentiation and development of the murine embryonic gonad JOURNAL Biol Reprod 72 (2), 492-501 (2005) PUBMED 15496517 REFERENCE 8 (bases 1 to 882) AUTHORS Takasaki N, McIsaac R and Dean J. TITLE Gpbox (Psx2), a homeobox gene preferentially expressed in female germ cells at the onset of sexual dimorphism in mice JOURNAL Dev Biol 223 (1), 181-193 (2000) PUBMED 10864470 REFERENCE 9 (bases 1 to 882) AUTHORS Chun JY, Han YJ and Ahn KY. TITLE Psx homeobox gene is X-linked and specifically expressed in trophoblast cells of mouse placenta JOURNAL Dev Dyn 216 (3), 257-266 (1999) PUBMED 10590477 REFERENCE 10 (bases 1 to 882) AUTHORS Han YJ, Park AR, Sung DY and Chun JY. TITLE Psx, a novel murine homeobox gene expressed in placenta JOURNAL Gene 207 (2), 159-166 (1998) PUBMED 9511757 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AF017453.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AF017453.1, DQ058643.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849385, SAMN01164131 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. FEATURES Location/Qualifiers source 1..882 /organism="Mus musculus" /mol_type="mRNA" /db_xref="taxon:10090" /chromosome="X" /map="X 22.08 cM" gene 1..882 /gene="Rhox6" /gene_synonym="Psx1" /note="reproductive homeobox 6" /db_xref="GeneID:19202" /db_xref="MGI:MGI:1202888" exon 1..125 /gene="Rhox6" /gene_synonym="Psx1" /inference="alignment:Splign:2.1.0" CDS 44..727 /gene="Rhox6" /gene_synonym="Psx1" /note="placenta specific homeobox 1" /codon_start=1 /product="reproductive homeobox on X chromosome, 6" /protein_id="NP_032981.1" /db_xref="CCDS:CCDS30080.1" /db_xref="GeneID:19202" /db_xref="MGI:MGI:1202888" /translation="
METPQDSRQSIQKPPSPAAEEDKEEQPGGNAVVSGAPEERIDKKELVLNWLAQGEFDQGEGAQGEVAGGEQAQEEPAPLSPAQEATGGEEEGENKEGEMEGRHAGDGASSSEDDSILEEGGENIDQQPPQQEAASPDSIRNPHVLNRLAQLRYRRTRFTHSQLHDLERLFQETRYPSLRARRDLARWMGVDECDVQNWFRMRRALFQRNRRVLMFCELPPLPQSDSP"
misc_feature 497..667 /gene="Rhox6" /gene_synonym="Psx1" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" exon 126..585 /gene="Rhox6" /gene_synonym="Psx1" /inference="alignment:Splign:2.1.0" exon 586..631 /gene="Rhox6" /gene_synonym="Psx1" /inference="alignment:Splign:2.1.0" exon 632..865 /gene="Rhox6" /gene_synonym="Psx1" /inference="alignment:Splign:2.1.0" ORIGIN
ggaagcctcttcgggagcagcgtcggatccagagattctcgctatggaaactcctcaagacagccgccaaagcatccaaaagcctccgagtccggcagccgaggaggacaaggaagaacagcctggtgggaatgcagtggtctccggggctccagaggaaagaatagacaagaaagagcttgtactgaactggctcgctcagggtgagtttgatcagggcgaaggcgctcagggcgaggttgctggaggtgagcaggctcaagaagagcctgctccattgagtccagctcaggaagccactggaggagaagaggagggagaaaacaaggaaggagaaatggaaggaagacatgctggtgatggtgcttctagctccgaggatgacagcatcctggaagaaggcggcgaaaacatagatcaacagccgcctcagcaagaggcagccagtcctgatagcatcagaaacccacatgttctgaataggctggctcaactgcggtacagacgcaccaggttcacccactctcagctgcatgacctggagcgccttttccaagagactcgctaccccagcttgcgagcaaggagggatcttgcacgatggatgggtgtggatgaatgtgatgtgcagaattggtttcggatgaggagagcccttttccagagaaacaggagagtgctgatgttctgcgaactgccgcctcttccccagagcgactctccctgaagattttggagcagcacttgagtgccagccctgtcatggagccagatgaggatggcttcttctgagccacccatgatggccatgacaaccttttcttctctacaattatttcagcaataaagatgagcattctgaataaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]