GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-10-14 09:10:18, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       NM_007524               1437 bp    mRNA    linear   ROD 27-APR-2025
DEFINITION  Mus musculus NK3 homeobox 2 (Nkx3-2), mRNA.
ACCESSION   NM_007524
VERSION     NM_007524.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1437)
  AUTHORS   Schonblum,A., Ali Naser,D., Ovadia,S., Egbaria,M., Puyesky,S.,
            Epshtein,A., Wald,T., Mercado-Medrez,S., Ashery-Padan,R. and
            Landsman,L.
  TITLE     Beneficial islet inflammation in health depends on pericytic
            TLR/MyD88 signaling
  JOURNAL   J Clin Invest 134 (14), e179335 (2024)
   PUBMED   38885342
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1437)
  AUTHORS   Melzer,M.K., Schirge,S., Gout,J., Arnold,F., Srinivasan,D.,
            Burtscher,I., Allgower,C., Mulaw,M., Zengerling,F., Gunes,C.,
            Lickert,H., Christoffels,V.M., Liebau,S., Wagner,M.,
            Seufferlein,T., Bolenz,C., Moon,A.M., Perkhofer,L. and Kleger,A.
  TITLE     TBX3 is dynamically expressed in pancreatic organogenesis and
            fine-tunes regeneration
  JOURNAL   BMC Biol 21 (1), 55 (2023)
   PUBMED   36941669
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1437)
  AUTHORS   Burganova,G., Schonblum,A., Sakhneny,L., Epshtein,A., Wald,T.,
            Tzaig,M. and Landsman,L.
  TITLE     Pericytes modulate islet immune cells and insulin secretion through
            Interleukin-33 production in mice
  JOURNAL   Front Endocrinol (Lausanne) 14, 1142988 (2023)
   PUBMED   36967785
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1437)
  AUTHORS   Cotton,J.L., Dang,K., Hu,L., Sun,Y., Singh,A., Rajurkar,M.S.,
            Li,Q., Wu,X. and Mao,J.
  TITLE     PTEN and LKB1 are differentially required in Gli1-expressing
            mesenchymal cells to suppress gastrointestinal polyposis
  JOURNAL   Cell Rep 40 (3), 111125 (2022)
   PUBMED   35858546
REFERENCE   5  (bases 1 to 1437)
  AUTHORS   Sakhneny,L., Mueller,L., Schonblum,A., Azaria,S., Burganova,G.,
            Epshtein,A., Isaacson,A., Wilson,H., Spagnoli,F.M. and Landsman,L.
  TITLE     The postnatal pancreatic microenvironment guides beta cell
            maturation through BMP4 production
  JOURNAL   Dev Cell 56 (19), 2703-2711 (2021)
   PUBMED   34499867
REFERENCE   6  (bases 1 to 1437)
  AUTHORS   Tanaka,M., Kasahara,H., Bartunkova,S., Schinke,M., Komuro,I.,
            Inagaki,H., Lee,Y., Lyons,G.E. and Izumo,S.
  TITLE     Vertebrate homologs of tinman and bagpipe: roles of the homeobox
            genes in cardiovascular development
  JOURNAL   Dev Genet 22 (3), 239-249 (1998)
   PUBMED   9621431
REFERENCE   7  (bases 1 to 1437)
  AUTHORS   Yoshiura,K.I. and Murray,J.C.
  TITLE     Sequence and chromosomal assignment of human BAPX1, a
            bagpipe-related gene, to 4p16.1: a candidate gene for skeletal
            dysplasia
  JOURNAL   Genomics 45 (2), 425-428 (1997)
   PUBMED   9344671
REFERENCE   8  (bases 1 to 1437)
  AUTHORS   Wightman,P.J., Hayward,B.E. and Bonthron,D.T.
  TITLE     The genes encoding glucokinase regulatory protein and
            ketohexokinase co-localize to mouse chromosome 5
  JOURNAL   Mamm Genome 8 (9), 700-701 (1997)
   PUBMED   9271679
REFERENCE   9  (bases 1 to 1437)
  AUTHORS   Chen,X. and Lufkin,T.
  TITLE     Linkage mapping of Sax2 to mouse chromosome 5
  JOURNAL   Mamm Genome 8 (9), 697-698 (1997)
   PUBMED   9271676
REFERENCE   10 (bases 1 to 1437)
  AUTHORS   Tribioli,C., Frasch,M. and Lufkin,T.
  TITLE     Bapx1: an evolutionary conserved homologue of the Drosophila
            bagpipe homeobox gene is expressed in splanchnic mesoderm and the
            embryonic skeleton
  JOURNAL   Mech Dev 65 (1-2), 145-162 (1997)
   PUBMED   9256352
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            U87957.1 and BC145874.1.
            
            On Nov 24, 2007 this sequence version replaced NM_007524.2.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC145872.1, BC021014.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849376, SAMN00849377
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-5                 U87957.1           1-5
            6-1437              BC145874.1         1-1432
FEATURES             Location/Qualifiers
     source          1..1437
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10090"
                     /chromosome="5"
                     /map="5 22.58 cM"
     gene            1..1437
                     /gene="Nkx3-2"
                     /gene_synonym="Bapx1; Nkx-3.2; NKX3.2"
                     /note="NK3 homeobox 2"
                     /db_xref="GeneID:12020"
                     /db_xref="MGI:MGI:108015"
     exon            1..742
                     /gene="Nkx3-2"
                     /gene_synonym="Bapx1; Nkx-3.2; NKX3.2"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    82..84
                     /gene="Nkx3-2"
                     /gene_synonym="Bapx1; Nkx-3.2; NKX3.2"
                     /note="upstream in-frame stop codon"
     CDS             277..1278
                     /gene="Nkx3-2"
                     /gene_synonym="Bapx1; Nkx-3.2; NKX3.2"
                     /note="homeodomain protein Nkx-3.2; homeobox protein NK-3
                     homolog B; bagpipe homeobox protein homolog 1; bagpipe
                     homeobox gene 1 homolog"
                     /codon_start=1
                     /product="homeobox protein Nkx-3.2"
                     /protein_id="NP_031550.2"
                     /db_xref="CCDS:CCDS19259.1"
                     /db_xref="GeneID:12020"
                     /db_xref="MGI:MGI:108015"
                     /translation="
MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ"
     misc_feature    496..639
                     /gene="Nkx3-2"
                     /gene_synonym="Bapx1; Nkx-3.2; NKX3.2"
                     /note="propagated from UniProtKB/Swiss-Prot (P97503.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    685..912
                     /gene="Nkx3-2"
                     /gene_synonym="Bapx1; Nkx-3.2; NKX3.2"
                     /note="propagated from UniProtKB/Swiss-Prot (P97503.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    895..1065
                     /gene="Nkx3-2"
                     /gene_synonym="Bapx1; Nkx-3.2; NKX3.2"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            743..1437
                     /gene="Nkx3-2"
                     /gene_synonym="Bapx1; Nkx-3.2; NKX3.2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gaagagataatcggccgggctgtaggagaagagcatctggcgctggattccaggggagggggtcctggcgaggtgggcctgtgaggtggggtgagggtcggcgcggatcctggaactgaggggggcgggggctgctgtgctgcgcaggagtgggttgcgggggcctggcgcgcccctctcactcgcgctgaggtcgcccagagctccgtgtcaggctcgaagctgtccccgcgccccagttgccctcctggctgccggctccgatctgcggcgcagatggctgtgcgcggcagcggcaccttgacgcccttctccatccaggcgatcctcaacaagaaagaggagcgcggcgggttggctacgccggaggggcgcccggcaccagggggcacagaggtggcggtgaccgcggcgcccgccgtctgctgctggcggatcttcggggagaccgaggccggtgcgctggggggcgccgaggactctcttctggcatctcccgcccgaaccagaacagccgtggggcagagcgcagagagtccgggaggttgggactcagactcagccctgagcgaagagaacgagggcaggaggcgctgcgccgatgtcccgggagccagtggaaccggccgcgccagggtgaccctgggcctggaccagccaggctgcgagctgcacgccgccaaggacctggaggaggaagccccggtccgcagcgacagcgagatgtcagccagcgtttcaggcgaccacagcccgagaggcgaggatgacagcgttagccctggaggtgcacgcgtgcctgggttgcgcggcgccgcgggcagcggggctagcggcgggcaggcgggcggcgtggaggaggaggaagagcccgcagcccctaaaccgcgaaagaagcgctcccgggccgccttctcgcacgcccaggtcttcgagctggagcgccgctttaaccatcagcgctacctgtccgggccggagcgcgcagacctggcagcttcgctgaagctcacagagacgcaagtgaagatctggtttcagaaccgtcgctacaagaccaaacgccggcagatggccgccgacctgctcgcctctgcacccgccgccaagaaagtggccgtaaaggtgctggtgcgtgacgaccaaagacagtatttgcccggagaggtgctgaggccaccttcccttctgccactgcagccctcctactactacccttactactgtctcccgggctgggcgctgtccacgtgcgcggccgctgctggtacccagtgaagcccttgggacgaggcaaagaaggattcctgcgtcccccgtatgcaccgccacggacaggtgtactctgtgcaggcgagttctgctcaactggggatgaggcaggtggggaatgaaatcctgctgggacttgacacacctatccagggtgacagggcc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]