LOCUS       NM_001426061            2141 bp    mRNA    linear   ROD 20-FEB-2024
DEFINITION  Mus musculus solute carrier family 35 (UDP-galactose transporter),
            member A2 (Slc35a2), transcript variant 4, mRNA.
ACCESSION   NM_001426061
VERSION     NM_001426061.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 2141)
  AUTHORS   Cheng,H., Wang,S., Gao,D., Yu,K., Chen,H., Huang,Y., Li,M.,
            Zhang,J. and Guo,K.
  TITLE     Nucleotide sugar transporter SLC35A2 is involved in promoting
            hepatocellular carcinoma metastasis by regulating cellular
            glycosylation
  JOURNAL   Cell Oncol (Dordr) 46 (2), 283-297 (2023)
   PUBMED   36454514
  REMARK    GeneRIF: Nucleotide sugar transporter SLC35A2 is involved in
            promoting hepatocellular carcinoma metastasis by regulating
            cellular glycosylation.
REFERENCE   2  (bases 1 to 2141)
  AUTHORS   Hayashi,Y., Ito,Y., Yanagiba,Y., Kamijima,M., Naito,H. and
            Nakajima,T.
  TITLE     Differences in metabolite burden of di(2-ethylhexyl)phthalate in
            pregnant and postpartum dams and their offspring in relation to
            drug-metabolizing enzymes in mice
  JOURNAL   Arch Toxicol 86 (4), 563-569 (2012)
   PUBMED   22159897
  REMARK    GeneRIF: DEHP exposure did not influence lipase activity, whereas
            it slightly enhanced UGT activity and exclusively increased CYP4A14
            levels in pregnant and/or postpartum dams.
REFERENCE   3  (bases 1 to 2141)
  AUTHORS   Oelmann,S., Stanley,P. and Gerardy-Schahn,R.
  TITLE     Point mutations identified in Lec8 Chinese hamster ovary
            glycosylation mutants that inactivate both the UDP-galactose and
            CMP-sialic acid transporters
  JOURNAL   J Biol Chem 276 (28), 26291-26300 (2001)
   PUBMED   11319223
REFERENCE   4  (bases 1 to 2141)
  AUTHORS   Means,G.D., Toy,D.Y., Baum,P.R. and Derry,J.M.
  TITLE     A transcript map of a 2-Mb BAC contig in the proximal portion of
            the mouse X chromosome and regional mapping of the scurfy mutation
  JOURNAL   Genomics 65 (3), 213-223 (2000)
   PUBMED   10857745
REFERENCE   5  (bases 1 to 2141)
  AUTHORS   Ishida,N., Yoshioka,S., Iida,M., Sudo,K., Miura,N., Aoki,K. and
            Kawakita,M.
  TITLE     Indispensability of transmembrane domains of Golgi UDP-galactose
            transporter as revealed by analysis of genetic defects in
            UDP-galactose transporter-deficient murine had-1 mutant cell lines
            and construction of deletion mutants
  JOURNAL   J Biochem 126 (6), 1107-1117 (1999)
   PUBMED   10578063
REFERENCE   6  (bases 1 to 2141)
  AUTHORS   Ishida,N., Miura,N., Yoshioka,S. and Kawakita,M.
  TITLE     Molecular cloning and characterization of a novel isoform of the
            human UDP-galactose transporter, and of related complementary DNAs
            belonging to the nucleotide-sugar transporter gene family
  JOURNAL   J Biochem 120 (6), 1074-1078 (1996)
   PUBMED   9010752
REFERENCE   7  (bases 1 to 2141)
  AUTHORS   Lennon,G., Auffray,C., Polymeropoulos,M. and Soares,M.B.
  TITLE     The I.M.A.G.E. Consortium: an integrated molecular analysis of
            genomes and their expression
  JOURNAL   Genomics 33 (1), 151-152 (1996)
   PUBMED   8617505
REFERENCE   8  (bases 1 to 2141)
  AUTHORS   Hara,T., Yamauchi,M., Takahashi,E., Hoshino,M., Aoki,K., Ayusawa,D.
            and Kawakita,M.
  TITLE     The UDP-galactose translocator gene is mapped to band
            Xp11.23-p11.22 containing the Wiskott-Aldrich syndrome locus
  JOURNAL   Somat Cell Mol Genet 19 (6), 571-575 (1993)
   PUBMED   8128316
REFERENCE   9  (bases 1 to 2141)
  AUTHORS   Hara,T., Hattori,S. and Kawakita,M.
  TITLE     Isolation and characterization of mouse FM3A cell mutants which are
            devoid of Newcastle disease virus receptors
  JOURNAL   J Virol 63 (1), 182-188 (1989)
   PUBMED   2535724
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AL671978.2.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR13422586.46310.1,
                                           SRR17253012.929610.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849376, SAMN00849378
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-101               AL671978.2         40630-40730
            102-253             AL671978.2         45909-46060
            254-2141            AL671978.2         48437-50324
FEATURES             Location/Qualifiers
     source          1..2141
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="X"
                     /map="X 3.56 cM"
     gene            1..2141
                     /gene="Slc35a2"
                     /gene_synonym="Had-1; Had1; Sfc8; Ugalt; UGT"
                     /note="solute carrier family 35 (UDP-galactose
                     transporter), member A2"
                     /db_xref="GeneID:22232"
                     /db_xref="MGI:MGI:1345297"
     exon            1..101
                     /gene="Slc35a2"
                     /gene_synonym="Had-1; Had1; Sfc8; Ugalt; UGT"
                     /inference="alignment:Splign:2.1.0"
     CDS             11..1000
                     /gene="Slc35a2"
                     /gene_synonym="Had-1; Had1; Sfc8; Ugalt; UGT"
                     /note="isoform 4 is encoded by transcript variant 4;
                     solute carrier family 35 (UDP-galactose transporter)
                     member 2; mUGT1; UDP-Gal-Tr; solute carrier family 35
                     member A2; solute carrier family 35 (UDP-galactose
                     transporter), member 2; UDP-galactose translocator; solute
                     carrier family (UDP-N-acetylglucosamine transporter),
                     member 2"
                     /codon_start=1
                     /product="UDP-galactose translocator isoform 4"
                     /protein_id="NP_001412990.1"
                     /db_xref="GeneID:22232"
                     /db_xref="MGI:MGI:1345297"
                     /translation="

MAAVGVGGSTAAAGAGAVSSGALEPGSTTAGNVKHLVLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVAIVQAQQAGGSGPRPLDQNPGAGLAAVVASCLSSGFAGVYFEKILKGSSGSVWLRNLQLGLFGTALGLVGLWWAEGTAVASQGFFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFATSLSIVLSTVASIRLFGFHLDPLFALGAGLVIGAVYLYSLPRGAVKAIASASASGPCIHQQPPGQPPPPQLSSRGDLTTEPFLPKSVLVK"

     exon            102..253
                     /gene="Slc35a2"
                     /gene_synonym="Had-1; Had1; Sfc8; Ugalt; UGT"
                     /inference="alignment:Splign:2.1.0"
     exon            254..2141
                     /gene="Slc35a2"
                     /gene_synonym="Had-1; Had1; Sfc8; Ugalt; UGT"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

agatgccaacatggcagcggttggggttggtggatctaccgctgcggccggggctggggctgtgtcctcgggcgcgttggaacctgggtccactacagcgggtaatgtgaagcacctggtcctcttcctccatgaggctgtcctggtccaatatgtggacacactcaagcttgcggtgccctctctcatctataccttgcagaataacctccagtatgttgccatcagcaacctgccagctgccactttccaggtgacatatcagctgaagatcctgactacagcgctcttctctgtgctcatgttgaatcgcagcctctcacgcctgcagtgggcctctctgctgctgctcttcactggtgtcgccattgtccaggcacagcaagctggtgggagtggcccacggccactggatcagaacccgggggcgggcttagcggcagttgtggcctcctgtctctcctcaggcttcgctggggtctactttgagaagatcctcaaaggcagctcaggttctgtgtggcttcgtaacctacagctcggcctctttggcacagcgctgggcctggtggggctctggtgggctgagggcaccgccgtggccagtcaaggcttcttctttgggtacacacctgctgtctggggtgtagtactaaaccaagcctttggtgggcttctggtggctgttgttgtcaagtatgctgacaacatcctcaagggctttgccacctccctgtctattgtgctgtccactgttgcctccattcgcctctttggcttccacctggacccattatttgccctgggcgctgggctcgtcattggtgctgtctacctctacagccttccccgaggtgcagtcaaagccatagcctcggcctcggcctctgggccctgcattcaccagcagcctcctgggcagccaccaccaccgcagctgtcttctcgaggagacctcaccacggagccctttctgccaaagtcagtgctggtcaagtgagagctggtggtggttgggggaacagggcagggggttgggttggagggggttgggcttctgcaggtccaaaaagttgttgccagggcctggcttttgtgggttggaggtttattttctcccataattctagagggatatggaactagggctgaatgtcacatgaacgcttcctgatagatggactctcctctcctggaggagctttttagagctgcttcctctgccttgggctaacctctttgggaacagggttggggtactgctattccaggcctttcccccatgaccctgtgctggagatgtcctgtctcgcatgcctgggacagtccctcccagccatcctgcagactggataaaagccctgcagctctccaataacgactaatgactcctcgtggggttcatttcctattgtatgaggtcttctctcctgcaccatcaccctggatcatgacaacagcgtggtctctgctgtggctttggggcagtttccccggtacagagacccttgaagagcaatcagcctgttgtaagtgcccggaacgaggagagaggcacaagctgaggatttcgcatcagctcatcttggggagggtgcaataagtgccatttgctttccaatagtttgggatggagatttgtttgtgctatcattagatcaatgatccagcgtgttgggaaaatggggaggggaggtccttgaagtggctgaatctcatgtaattgacgagacagaggcgaaggattctcttcagaaacatccagacaaaaactaaagctgccgatccgcctgcagctccattggcgtttaaaacatcctttcaggatgggtgtcagaattgatgaaacatggaacctgcgcccctgcactccccaaagcttattaactccttaactgtatcccagatgtgtgtgtgtgtgtgtgttcgcgcgcgcgtggggatgtgtgtggatgtgtgcacgcacacttaagtgcatgcatggaaggtgcctgggctgtctttgctatatgtaaatagggccactggatctttatttttgattaatttgttctgattttttttttggtttgttttttaaggaactgtaatgaacaaatgtcaggatacccaatgccaaataaagatgatgtatttattta

//